(data stored in ACNUC7421 zone)

EMBL: AP009493.PE273

AP009493.PE273       Location/Qualifiers
FT   CDS_pept        complement(290246..291286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_273"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_273"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17102"
FT                   /db_xref="GOA:B1VNS9"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNS9"
FT                   /protein_id="BAG17102.1"
FT                   /translation="MNRRPPSAWTALRRSRALLAVGAAAGPWKRGRGLAVAALLLGLLL
FT                   PLHASIPNGVGNLGSLVETFLPWFGLLIPVLLAGALLRRSLLAGAALLLPAVVWLHLFG
FT                   GLLADKSRQGGDLTVVSHNVGADNPDAVGTARALAAAGADVLALEELDPADRRTYEREL
FT                   ATAYPHHTVLGTVGVWSRLPLSDTRPVDVAMDAGPLGDAKPAEVKLAYNRGLRTTVATD
FT                   HGPLAVYVAHLGSVRVNPRAGLSSGQRDAGARSLGRAVAAERNERVVLLGDLNGTLDDR
FT                   AYAGITSRMRSAQEVAGDGFGFSWPATFPVARIDQILVRGVEPESSWLLPATGSDHLPV
FT                   AARVSW"
     atgaatcgac gaccgccttc agcgtggaca gcactccgcc ggtcgcgtgc gcttctcgcc        60
     gtcggcgcgg cggcagggcc ctggaagcgc ggccgggggc tcgccgtcgc ggcgctgctg       120
     ctgggcctgc tcctgccgct gcacgcgagc atcccgaacg gggtggggaa cctcggcagc       180
     ctggtggaga ccttcctccc gtggttcggc ctcctcatcc cggtgctgct ggccggggcg       240
     ctgctgcgcc gctccctcct cgcgggcgcc gcgctcctgc tgccggccgt cgtgtggctg       300
     cacctcttcg gcgggctgct cgccgacaag tcccgccagg gcggagacct caccgtggtc       360
     agccacaacg tcggcgccga caaccccgac gcggtgggca ccgcccgcgc cctggccgcc       420
     gccggcgccg acgtgctggc actggaggag ctggatccgg cggaccggag gacgtacgag       480
     agggagctgg cgacggccta cccccaccac accgtgctgg gcaccgtcgg tgtgtggagc       540
     aggctgccgc tgtcggacac ccggccggtc gacgtcgcga tggacgcggg gccgctgggg       600
     gacgcgaagc ccgccgaggt caagctggcg tacaaccggg gactgcgcac cacggtggcc       660
     acggaccacg ggcccctggc ggtgtacgtg gcgcacctcg gatccgtgcg ggtgaaccct       720
     cgggcgggcc tctcctcggg gcaacgggac gccggcgcgc ggtcgctcgg ccgggccgtc       780
     gccgccgagc ggaacgagcg ggtggtgctg ctcggcgatc tcaacgggac cctggacgac       840
     cgtgcgtacg cgggcatcac ctcgcggatg cgctcggcgc aggaggtggc cggcgacggg       900
     ttcggcttca gctggcccgc caccttcccg gtggcgcgga tcgaccagat tctcgtacgg       960
     ggcgtggagc cggagagctc gtggctcctg cccgccaccg gtagcgacca cctcccggtg      1020
     gccgcccgcg tcagctggtg a                                                1041
//

If you have problems or comments...

PBIL Back to PBIL home page