(data stored in ACNUC7421 zone)

EMBL: AP009493.PE275

AP009493.PE275       Location/Qualifiers
FT   CDS_pept        292052..293350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_275"
FT                   /product="putative two-component system sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_275"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17104"
FT                   /db_xref="GOA:B1VNT1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNT1"
FT                   /protein_id="BAG17104.1"
FT                   /translation="MTRACRHTAVVARRAAGRRLARAIARRRSGLVAELPGHFGNAASV
FT                   RARHRPAGGSVTTDPRRPGLSVRLKLTLSYAGFLMVAGVLLLTAVWVFLLEYVPDDWDR
FT                   RMLHENPNRQLLAYTFAPAAATVLAVLLVVGLLGGWVLAGRMLAPLTRITEATRAATHG
FT                   SLAHRIRLPGRRDEFRELADAFDTMLARLEAHVAEQERFAANASHELRTPLAISRTLLD
FT                   VARADPNRDPDEIIDRLYAVNGRAIDLTEALLVLSRADRRSFARERVDLSLLAEEAAET
FT                   LLPLAEEHGVTVETHGEIAPATGSPALLLQLTTNLVHNAIVHNLPDGGTVRVTASVRPE
FT                   TVVLTVDNTGAKVTPQLAATLTEPFRRGAGRLHTHHAGVGLGLAIVKTITRAHDGTLTL
FT                   VPRPDGGLRVTVELPASAPPADGTGTPYGRMEP"
     gtgactaggg cctgtcgtca cactgccgtc gtcgcccgaa gggcggccgg gcggcgcctg        60
     gcgcgtgcga tcgcgaggcg ccgcagtggc ctcgtggcgg agctgccagg gcatttcggc       120
     aacgccgcga gcgtgcgtgc caggcatcgc ccggcaggcg gcagtgtgac gacagacccc       180
     aggcgccccg ggctgagcgt ccgtctcaag ctcaccctca gctacgccgg attcctcatg       240
     gtcgccggcg tcctgctgct cacggcggtg tgggtgttcc tcctggagta cgttcccgac       300
     gactgggacc ggcggatgct ccacgagaat cccaaccgtc agcttctcgc gtacaccttc       360
     gctccggcgg cggccaccgt gctggcggtc ctcctcgtcg tcggcctcct gggaggatgg       420
     gtcctggccg gccgtatgct cgccccgctg acccggatca ccgaagccac ccgcgcggcc       480
     acccacgggt cgctcgccca ccgcatcagg ctgccgggcc gcagggacga gttccgtgaa       540
     ctcgccgacg cgttcgacac gatgctggcc cggctcgagg cacacgtcgc cgaacaggag       600
     aggttcgcgg ccaacgcctc ccacgagctg cgcacgccgc tggcgatctc cagaacgctt       660
     ctcgatgtgg cccgcgccga tccgaaccgc gaccccgacg agatcatcga ccgcctgtac       720
     gccgtcaacg gcagagcgat cgacctcacc gaggccctgc tcgtgctcag ccgggccgac       780
     cggcgttcct tcgcccggga acgggtcgac ctttcgctgc tggccgagga ggccgccgag       840
     accctcctgc ccctcgcgga ggagcacggc gtcaccgtcg agacccacgg cgagatcgcc       900
     cccgcgaccg gatcgcccgc gctcctgctc cagctgacca cgaatctcgt gcacaacgcg       960
     atcgtccaca acctgcccga cggcggcacg gtccgggtca ccgcctcggt ccggccggag      1020
     accgtggtgc tcacggtcga caacacgggc gcgaaggtca ccccccagtt ggccgcgacg      1080
     ctcaccgaac ccttccggcg tggcgccgga cggctgcaca cccaccacgc gggggtcggg      1140
     ctcggcctgg ccatcgtcaa gaccatcacc cgcgcgcacg acgggacgct caccctcgtc      1200
     ccgcgtccgg acggcgggct gcgcgtcacg gtggaactcc ccgcgtcagc cccgcccgcc      1260
     gacggaaccg gaacgccgta cggcaggatg gagccatga                             1299
//

If you have problems or comments...

PBIL Back to PBIL home page