(data stored in ACNUC7421 zone)

EMBL: AP009493.PE276

AP009493.PE276       Location/Qualifiers
FT   CDS_pept        293347..293673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_276"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_276"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17105"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNT2"
FT                   /protein_id="BAG17105.1"
FT                   /translation="MSVVKINVLTVPQEQRETLEKRFASRAHAVESSDGFEWFELLRPV
FT                   EGTDDYLVYTRWRDEASFQAWMEGPMKAAHQGGADGGERPKPAAGGSTVWSFEVVQQAA
FT                   PTGV"
     atgagcgtag tcaagatcaa tgtgctgacc gtcccccagg aacaacgcga gacgctggag        60
     aagcgcttcg cctcccgggc ccacgccgtg gagagctccg acggattcga gtggttcgag       120
     ctgctccggc ccgtcgaggg cacggacgac tacctcgtct acacgcgctg gcgtgacgag       180
     gcctccttcc aggcatggat ggaggggccg atgaaggcgg cccaccaggg cggcgccgac       240
     ggcggtgagc gccccaagcc ggcggccggc gggtccacgg tgtggtcctt cgaggtcgtg       300
     cagcaggccg ccccgaccgg cgtgtag                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page