(data stored in ACNUC7421 zone)

EMBL: AP009493.PE277

AP009493.PE277       Location/Qualifiers
FT   CDS_pept        complement(293789..294334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_277"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_277"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17106"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNT3"
FT                   /protein_id="BAG17106.1"
FT                   /translation="MCGVNVGTEETRLIVLRGNSASGKSSVAAGLRDRFGRGLAVVGQD
FT                   NLRRTVLRERDRPGAANIGLIDLTARYALDAGYHVVVEGILYADHYGDMLARLRADHRG
FT                   PTHGYYLDVPFAETVARHATKPIADEVDENQLRDWYRPRDVLPDGVETVIGPDSPLTGT
FT                   VDRILRDTGLALLPAVDR"
     gtgtgcggag tgaacgtggg gaccgaggag acccggctga tcgtcctgcg cggcaacagc        60
     gcgtcgggga agtcgagcgt ggcggcgggt ctccgcgacc gcttcggccg cggactggcc       120
     gtggtcggcc aggacaacct ccgccgtacc gtgctgcgcg aacgcgaccg gccaggggcg       180
     gcgaacatcg gtctgatcga cctgacagcc cgctacgccc tggacgccgg ctaccacgtg       240
     gtggtcgagg gcatcctcta cgccgaccac tacggcgaca tgctcgcccg gctgcgcgcc       300
     gaccaccggg gcccgaccca cgggtactac ctggacgtcc ccttcgccga gacggtggcc       360
     cggcacgcca ccaagccgat cgccgacgag gtcgacgaga accagctgcg ggactggtac       420
     cggccccgcg acgttctgcc cgacggcgtc gaaaccgtga tcggtcccga cagcccgctg       480
     accgggaccg tcgaccgcat cctgcgcgac accggcctgg ctctgcttcc ggcggtcgac       540
     cgctga                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page