(data stored in ACNUC7421 zone)

EMBL: AP009493.PE280

AP009493.PE280       Location/Qualifiers
FT   CDS_pept        307688..309091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_280"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_280"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17109"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNT6"
FT                   /protein_id="BAG17109.1"
FT                   /translation="MRGDLLSDPVEGLDEALAVVDAFDEALVAGLLRPGPAQAAAVVGL
FT                   AEAVAGTPLAARVAEAADRAKAGAAGEDHFVALAAARCALLGSVHDALTQRIDEAVGRP
FT                   AAEDGAAGPGPASAAADRGSNLLAAARSWLCDLARAGWRGIDHERVAGAAPVVSAMLPD
FT                   PVLRRRATLLDGFAAELAASCPGATLERVPLRRWADLWSRALLLTVPGSAGESAVTPVS
FT                   GRLLPLGVDVQEHATAVQAQVHAVFEPADGGVPRLVRAGVAAPKPDTVVGAGLWQLLRP
FT                   RMSLLGAVSEGRSMELDAMPVTAEGDLLWDDGRARPGEPADAFATARVMLSTAAAARVA
FT                   PLDRHPVRIAVPVLLEGYTARSEDDRLVFDLPGRSLAVDTDRAPAAGPLTPEAVAASHS
FT                   CVGLLRWDAGEFLLQPLAVEATVRKKAVAAHAGAWAGGTTDKAGVRAEKAATDAVTVLR
FT                   ERAGRLLRK"
     atgcgaggcg acctgttgtc cgatccggtc gaggggctcg acgaggcgct cgccgtcgtg        60
     gacgccttcg acgaggcgtt ggtggccggt ctgctgcggc cggggcccgc ccaggcagcg       120
     gcggtcgtcg ggctcgccga ggcggtcgcc gggacgccgc tcgccgcgcg ggtcgcggag       180
     gcggccgacc gggcgaaggc cggcgccgcg ggtgaggatc acttcgtggc gctcgccgcc       240
     gcccgctgcg cgctgctggg ctcggtgcac gacgccctga cgcagcggat cgacgaggcc       300
     gtcgggcggc ctgccgccga ggacggggcg gcggggcccg gaccggcgtc cgccgcggcg       360
     gaccgtgggt cgaaccttct cgcggcggcc cggagttggc tgtgcgacct cgcgcgcgcc       420
     ggctggcggg gcatcgacca cgaacgcgtc gccggggccg cgccggtggt ctccgcgatg       480
     ctgcccgatc cggtcctgcg tcgccgggcg acgctgctcg acggcttcgc cgcggagctc       540
     gcggcgtcct gcccgggggc gaccctggag cgcgtaccgc tgcgccgctg ggccgacctg       600
     tggtcacgcg ccctgctgtt gacggtgccc ggctccgccg gggagagtgc cgtcacgccg       660
     gtcagcggtc gcctgttgcc gctcggcgtc gatgtgcagg agcacgcgac ggccgtccag       720
     gcgcaggtcc acgccgtgtt cgaaccggcg gacggaggcg tgccgcgtct ggtgcgcgcc       780
     ggggtcgcgg cgcccaagcc ggacacggtc gtcggcgcgg gtctgtggca gctcctgcgt       840
     ccccgcatgt ccctgctcgg cgccgtgagc gagggccgct cgatggagct ggacgccatg       900
     ccggtgaccg ccgaggggga cctgctctgg gacgacgggc gtgcgcgtcc gggcgagccg       960
     gccgacgcct tcgccaccgc gcgggtgatg ctgtccaccg ctgccgccgc ccgtgtcgca      1020
     ccgctggacc ggcaccccgt ccggatcgcc gtgccggtgc tgctggaggg gtacaccgcc      1080
     cggagcgagg acgaccggct cgtgttcgat ctgccggggc ggtcgctggc cgtcgacacc      1140
     gaccgggcgc ccgccgccgg tccgctgacg cccgaggcgg tcgcggcctc ccactcctgc      1200
     gtcgggctgc tccgctggga tgccggggag ttcctgctcc agccgctcgc cgtcgaggcg      1260
     acggtgcgga agaaggccgt cgccgcccac gccggggcgt gggcgggcgg taccacggac      1320
     aaggccggtg tccgggcgga gaaggccgcc accgacgccg tcaccgtact gcgcgagcgc      1380
     gccggaaggc tgttgcggaa atga                                             1404
//

If you have problems or comments...

PBIL Back to PBIL home page