(data stored in ACNUC7421 zone)

EMBL: AP009493.PE281

AP009493.PE281       Location/Qualifiers
FT   CDS_pept        309088..310479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_281"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_281"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17110"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNT7"
FT                   /protein_id="BAG17110.1"
FT                   /translation="MTEHRTGQPPGSAGPGPSPAAPDPYDNRRQVLYWRLLARLFDGEE
FT                   QPALESASLEVVEDIGLPSALLDPGTSLDSVVQRHPELAAKFDGLMTPGDGAADDRDRA
FT                   AEVRRAALVSKVLLNVFARGSSTVTAEQLARWQSDADWLERALGCPPGGLRGGRAAGAG
FT                   PAGGGLGPELAAIEADLVGRMRLREVLADPALAARLTPSMSLIEQLLRDKGNLSGVALA
FT                   NAKSLIRRYVDEVAEVLRTQVEKATVGELDRSVPPKRVFRNLDLDRTIWKNLTNWSPEE
FT                   ERLYVDRLYYRHTVRRTTPQRLIVVVDQSGSMVDSMVNCTVLASIFAGLPKVDVHLIAY
FT                   DTRSIDLTPWVHDPFDVLLRTNLGGGNDGPVAMAMARPKIAEPRNTVMVWISDFYEFDR
FT                   SQPLFEGIEAVHRSGVKFIPVGSVTSSGRQEVNPWFRERFKALGTPVVSGHVSQLVHEL
FT                   KTFLT"
     atgaccgagc accgcaccgg gcagccgccc ggttccgccg ggcccggccc ctccccggcc        60
     gctcccgacc cgtacgacaa ccgccgtcag gtgctgtact ggcgcctcct ggcccgtctc       120
     ttcgacgggg aggagcagcc ggcgctggag tcggcgagcc tggaggtggt cgaggacatc       180
     gggctgccgt ccgcgttgct ggatcccggg acgtcgctcg actcggtcgt gcagcgccac       240
     ccggagctgg ccgccaagtt cgacggtctg atgacaccgg gcgacggcgc ggccgacgac       300
     cgcgaccggg cggcggaagt gcggcgtgcc gccctggtgt cgaaggtgct gctcaacgtc       360
     ttcgcccgtg gttcgagcac cgtgacggca gagcaactgg cgcgctggca gtccgacgcg       420
     gactggctgg agcgtgcgct gggctgtccg cccggcgggc ttcgcggtgg gcgtgcggcg       480
     ggcgcgggtc cggccggcgg cggcctcggc cccgagctgg ccgcgatcga ggcggatctg       540
     gtggggcgca tgcggctgcg ggaggtgctg gccgacccgg cgctggccgc ccggctgacg       600
     cccagcatgt ccctgatcga gcagttgctg cgggacaagg gcaatctgtc gggtgtggcc       660
     ctagccaacg ccaagtcgct catccgccgg tatgtggacg aggtggccga ggtgctgcgt       720
     acgcaggtgg agaaggccac cgtcggcgag ctggaccgtt cggtgccgcc caagcgcgtc       780
     ttccgcaatc tcgacctgga ccgcacgatc tggaagaacc tcaccaactg gagcccggag       840
     gaggagcggc tctacgtcga tcgcctctac taccggcaca ccgtccgcag gaccacgccg       900
     cagcggctga tcgtcgtggt ggaccagtcg ggctccatgg tcgactccat ggtgaactgc       960
     accgtcctcg cctccatctt cgcggggctg ccgaaggtgg acgtgcatct catcgcctac      1020
     gacacccgct cgatcgacct cacaccctgg gtgcacgacc cgttcgacgt gctgttgcgg      1080
     acgaacctcg gcggtgggaa cgacggcccc gtcgcgatgg cgatggcccg cccgaagata      1140
     gccgagccga ggaacaccgt catggtgtgg atctcggact tctacgagtt cgaccgctcc      1200
     cagccgctgt tcgagggcat cgaggccgtt caccgctccg gggtgaagtt catcccggtc      1260
     ggctcggtga ccagctccgg gcggcaggag gtcaacccct ggttccgtga gcggttcaag      1320
     gccctgggca cgcccgtggt ctccgggcac gtgagccagc tcgtgcacga gctcaagacg      1380
     tttttgacct ga                                                          1392
//

If you have problems or comments...

PBIL Back to PBIL home page