(data stored in ACNUC7421 zone)

EMBL: AP009493.PE287

AP009493.PE287       Location/Qualifiers
FT   CDS_pept        complement(317672..318592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_287"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_287"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17116"
FT                   /db_xref="GOA:B1VNU3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNU3"
FT                   /protein_id="BAG17116.1"
FT                   /translation="MSTQTATPDAPPAPRRPGRRSAPPVRRRSRGITSRVMVNGVLAVV
FT                   AVYTLMPLTWLLIASTKSYRDLFATNPFSLGDFQFLANLNALLDYNDGVFVRWLLNSLL
FT                   YTVVASGLSTLISVACGYAFDKYAFRGRERWFGVVLVGVLIPSTVVQLPLYLMASELGL
FT                   VNTYWAVLIPSLVNPFGVYLARVFSEGYVPGEVLEAARMDGAGEVRTFREVALPMLAPG
FT                   FVTIFLFSFTANWNNFYGALMMLNDDRLYPVNLGLYMWNQNVYQQPELYPLVIIGSLVA
FT                   VVPLIVAFLCLQRFWRSGLTAGAVK"
     atgagcaccc agacagccac ccccgacgcg ccgcccgcgc cccgccgacc cggacgccgc        60
     tccgccccac cggtccgccg caggagccgg ggcatcacct cccgcgtcat ggtcaacggc       120
     gtgctcgccg tcgtcgccgt ctacaccctg atgccgctga cctggctcct catcgcctcc       180
     accaagagct accgggacct gttcgccacc aacccgttca gcctcggcga cttccagttc       240
     ctggccaacc tgaacgccct cctcgactac aacgacggag tcttcgtccg ctggctgctc       300
     aacagcctcc tgtacaccgt cgtcgcctcc ggcctctcca ccctcatctc ggtggcctgc       360
     ggctacgcct tcgacaagta cgccttccgc ggccgggaga ggtggttcgg ggtcgtcctc       420
     gtcggcgtcc tcatcccctc caccgtcgtg cagctcccgc tctacctgat ggcctccgaa       480
     ctgggcctcg tcaacaccta ctgggccgtc ctgatcccca gcctggtgaa cccgttcggc       540
     gtctacctcg cccgcgtctt ctccgagggg tacgtaccgg gcgaggtcct ggaagcggcc       600
     cggatggacg gggcgggaga ggtgcggacc ttcagggagg tggccctgcc gatgctggcg       660
     ccggggttcg tgaccatctt cctgttctcg ttcaccgcga actggaacaa cttctacggc       720
     gcgctcatga tgctcaacga cgaccggctc tacccggtca acctgggcct gtacatgtgg       780
     aaccagaacg tctaccagca gccggagctc tacccgctgg tcatcatcgg ctcgctcgtc       840
     gccgtcgtcc ccctgatcgt cgccttcctc tgcctccagc gcttctggcg ctcgggcctc       900
     accgcaggag ccgtcaagtg a                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page