(data stored in ACNUC7421 zone)

EMBL: AP009493.PE288

AP009493.PE288       Location/Qualifiers
FT   CDS_pept        complement(318589..319392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_288"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_288"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17117"
FT                   /db_xref="GOA:B1VNU4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNU4"
FT                   /protein_id="BAG17117.1"
FT                   /translation="MIYAAWMSLYREESSGLGFGGTERAFAGFGNFTEALGSEAFLRSF
FT                   GNIALYCALYIPAMVGGALVLALLVDSTMARARRFFQIAYFLPHAVPGLIASLIWLYLY
FT                   TPGLSPITDALDALGAQWNFFGQDEAIFSVVNISAWQWTGYNMIIFYAGLQAVPREVLE
FT                   AATVDGAGALRTALQVKIPMIRPTVVLTLLFTCVGAIQLFDAPKLVQLRANTMGEDWSP
FT                   TMFIYTAAFKGHDYGLAAASSLLLALVAGLLSFVVTKLGNRWKAS"
     atgatctacg cggcctggat gagcctctac cgtgaggagt cctccggcct ggggttcggc        60
     ggcaccgagc gggccttcgc cggattcggc aacttcaccg aagccctggg aagcgaggcg       120
     ttcctccgct cgttcgggaa catcgcgctc tactgcgcgc tctacatccc cgcgatggtc       180
     ggcggagcgc tcgtcctggc cctgctcgtc gactcgacca tggcccgggc ccggcgcttc       240
     ttccagatcg cctacttcct gccgcacgcg gtacccggcc tgatcgcctc gctgatctgg       300
     ctctacctct acacgccggg gctcagcccg atcaccgacg ccctcgacgc gctcggcgcc       360
     cagtggaact tcttcggcca ggacgaggcg atcttctcgg tcgtcaacat ctccgcctgg       420
     cagtggaccg gctacaacat gatcatcttc tacgccggtc tccaggccgt tccccgcgag       480
     gtcctggaag cggcgaccgt cgacggggcc ggggccctgc gcaccgccct ccaggtcaag       540
     atccccatga tccgtcccac cgtcgtgctg accctgctgt tcacgtgcgt cggcgccatc       600
     cagctgttcg acgcccccaa actcgtccag ttgcgcgcca acaccatggg cgaggactgg       660
     tcgccgacca tgttcatcta caccgcggcc ttcaagggcc acgactacgg cctggccgcc       720
     gcgagttccc tcctgctcgc cctcgtcgcc ggcctgctgt ccttcgtcgt caccaagctc       780
     ggcaaccggt ggaaggcctc atga                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page