(data stored in ACNUC7421 zone)

EMBL: AP009493.PE29

AP009493.PE29        Location/Qualifiers
FT   CDS_pept        34425..34676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_29t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_29t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16858"
FT                   /db_xref="UniProtKB/TrEMBL:B1VKN2"
FT                   /protein_id="BAG16858.1"
FT                   /translation="MITPASLTRLLVERRLGEPAPSWQTAGRLRWHDGATRGASVFAGA
FT                   MDDGTWIMVHSLSGQPLPTEEMAAQVLKNAVTKMSREI"
     gtgataacgc cggcctccct gaccaggctg ctcgtcgaac gacgtctcgg cgaacctgcg        60
     ccctcatggc agacggcggg ccgactgcgc tggcacgacg gcgcgaccag gggcgcatcc       120
     gtcttcgcgg gtgccatgga cgacggcacc tggatcatgg tccacagcct ctccggacag       180
     ccactgccga cggaagagat ggccgcccaa gtcctgaaga acgcggtgac caaaatgtcc       240
     cgagaaattt ga                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page