(data stored in ACNUC7421 zone)

EMBL: AP009493.PE293

AP009493.PE293       Location/Qualifiers
FT   CDS_pept        326141..326653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_293"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_293"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17122"
FT                   /db_xref="InterPro:IPR007061"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNU9"
FT                   /protein_id="BAG17122.1"
FT                   /translation="MTDDERIAPPLLGGERETLRAFLDYQRETLAMKCAGLDDDALRER
FT                   SMPPSALSLLALVRHLAEVERAWFRRVFEDGAAPMVWSAEPFDFQAAYDASASTGAEAF
FT                   AAWKAEVEISRRIEREADSLDLVGRQPRWGKEVSLRMVMVHVLVEYGRHNGHADLLREG
FT                   VDGTVGA"
     atgacggacg acgaacggat cgcgcctccg ctgctgggcg gcgagcgcga gacgttgagg        60
     gcctttctcg actatcagcg ggagaccctc gccatgaagt gcgcggggct ggacgacgac       120
     gcgttgcgcg agcggtcgat gccgccgtcc gccttgtcgc tgctggctct ggtgcggcat       180
     ctggcggaag tggaacgcgc ctggttccgg cgggtgttcg aggacggggc ggcccccatg       240
     gtgtggtccg cggagccctt cgacttccag gcggcgtacg acgcgagcgc ctcgaccggg       300
     gccgaggcgt tcgccgcctg gaaggccgag gtggagatct cgcgccggat cgagcgggag       360
     gccgactcac tggacctggt ggggcgtcag ccgcgctggg ggaaggaggt ctcgctgcgc       420
     atggtcatgg tccacgtcct ggtggagtac ggccggcaca acggtcacgc ggacctgctg       480
     cgggaaggag tggacggcac ggtgggggct tga                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page