(data stored in ACNUC7421 zone)

EMBL: AP009493.PE295

AP009493.PE295       Location/Qualifiers
FT   CDS_pept        complement(327549..327866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_295"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17124"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNV1"
FT                   /protein_id="BAG17124.1"
FT                   /translation="MAALRDRVLPQSPNVAARDANRADSGDAGAPVAHATSVAGGGPRT
FT                   EDTPMNLYDTPAERVRRNRERAEELGRAADRATDPEHRQRLREKALRLLREETAAEPRP
FT                   S"
     gtggccgccc tccgggaccg cgtcctcccg cagtcaccga acgtagccgc acgagatgcg        60
     aaccgggcgg actccggtga cgctggggct ccggtcgcgc acgcgacgtc ggtcgccggc       120
     ggaggaccgc ggacggagga cacccccatg aacctgtacg acaccccggc ggagcgagtc       180
     cgccgcaacc gggagcgcgc cgaggaactc ggccgcgccg cggaccgggc caccgacccc       240
     gagcaccggc agcggctgcg ggagaaggcg ctgcggctgc tccgcgagga gacggcggcc       300
     gaaccccgcc cttcctga                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page