(data stored in ACNUC7421 zone)

EMBL: AP009493.PE296

AP009493.PE296       Location/Qualifiers
FT   CDS_pept        complement(327873..328307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_296"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_296"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17125"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNV2"
FT                   /protein_id="BAG17125.1"
FT                   /translation="MNAEHRPPDSRHRRPEGVTDATVEALGALSKALETAERARGALYD
FT                   FHQLTGSADLALDDAVRLLRAAGHGRHAERVEREILGRNVIPGHWTFQIVEEYNATYYD
FT                   VFRTIEGGIRQELAEGRDHLHEAEMKAARRTEGHPDHTAE"
     atgaacgccg aacaccggcc gcccgattcg cggcaccgac gacccgaagg cgtgaccgac        60
     gcgaccgtcg aggccctcgg ggcactctcg aaggcgctgg agaccgccga gcgtgcccgc       120
     ggcgccctgt acgacttcca tcagctcacc ggcagcgccg acctcgcgct cgacgacgcc       180
     gtacgactcc tccgcgccgc gggacacgga cgacacgccg agcgggtcga acgcgagatc       240
     ctcggccgca acgtgatccc cgggcactgg accttccaga tcgtcgagga atacaacgcc       300
     acctactacg acgtgttccg gacgatcgaa ggggggatca ggcaggagct cgccgagggc       360
     cgcgaccacc tccacgaggc cgagatgaag gcggcccggc ggaccgaggg gcacccggac       420
     cacaccgccg aatga                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page