(data stored in ACNUC7421 zone)

EMBL: AP009493.PE297

AP009493.PE297       Location/Qualifiers
FT   CDS_pept        328499..329005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_297"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_297"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17126"
FT                   /db_xref="GOA:B1VNV3"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNV3"
FT                   /protein_id="BAG17126.1"
FT                   /translation="MRNDEQELYSVGEVAELLGLHVRTVRNYVRDGRLKAVRIGKQYRI
FT                   NKEDLAALTGRPTDATVPKPAPAPGHAEVSSIVEIDALGPDAAHRLGTFITASTQSGRE
FT                   ASRPLRIQTVYDEERTRMKIVILGGTAATADLLHMIDGLLDPDSGLFASAPTSTSSSAQ
FT                   RADHA"
     atgaggaatg atgagcagga gctctactcg gtcggcgagg tggccgagtt gctggggctg        60
     catgtgcgca ccgttcggaa ctacgtacgt gacggccggc tgaaggctgt ccggatcggc       120
     aagcagtacc ggatcaacaa ggaggacctg gccgctctga ccggccggcc gaccgacgcc       180
     acggtcccaa aaccggcgcc cgcaccgggg cacgccgagg tgtccagcat cgtggagatc       240
     gacgcgctcg gtccggacgc cgcccaccgg ctgggcacat tcatcaccgc gagcacgcag       300
     tccgggcggg aggcatcgcg cccgctgcgc atccagacgg tctacgacga ggagcgaacc       360
     cgcatgaaga tcgtcattct cggcggcacc gccgccaccg ccgatctgct gcacatgatc       420
     gacggcctgc tggacccgga cagcggcctg ttcgcctccg ccccgacgtc cacgtccagc       480
     tccgcgcaga gggcggacca tgcctga                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page