(data stored in ACNUC7421 zone)

EMBL: AP009493.PE298

AP009493.PE298       Location/Qualifiers
FT   CDS_pept        328998..329423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_298"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_298"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17127"
FT                   /db_xref="InterPro:IPR025438"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNV4"
FT                   /protein_id="BAG17127.1"
FT                   /translation="MPELVEYHGVPVLVCDASGDTIADVQDALDHLIGAAFTSAEVVAV
FT                   PSARLDDRFFDLSTGLAGAILQTCANYRLRLVVLGDIGHHLSAGSALSDLVSEANRGRD
FT                   IWFLSDLDALADRMAPNGDRRPSGRVDRPRDGAHRPG"
     atgcctgaac tcgtcgaata ccacggtgtc ccggtcctgg tgtgcgacgc ctccggagac        60
     accatcgccg atgtccagga cgccctcgac catctgatcg gggccgcgtt cacgtccgct       120
     gaggtggtgg cggtgccgtc cgcacggctg gacgaccgct tcttcgacct gagcaccggc       180
     ctcgccggag ccatcctgca gacatgcgcg aactaccggc tccgcctcgt cgtcctcggc       240
     gacatcggcc accacctgtc ggccggctcg gccctctccg acctcgtcag cgaggccaac       300
     cggggccggg acatctggtt cctgtccgat ctggacgctc tcgccgaccg aatggccccg       360
     aacggggacc gccggccgtc cggccgagtc gaccgtccgc gagacggagc tcatcgaccg       420
     gggtga                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page