(data stored in ACNUC7421 zone)

EMBL: AP009493.PE299

AP009493.PE299       Location/Qualifiers
FT   CDS_pept        complement(329513..330484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_299"
FT                   /product="putative sporulation-control protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_299"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17128"
FT                   /db_xref="InterPro:IPR009776"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNV5"
FT                   /protein_id="BAG17128.1"
FT                   /translation="MVFKKLLGALGVGGPSVDTVLEPGPALPGAVLTGEVRLRGGGSDV
FT                   TVDRISLLLVARVEREDQDEEHEGTVVLERFTVGGGFRLAEEAEHAVPFSVTLPWETPI
FT                   TELHGQHLGPVLGIRTELEIAGARDKGDLDALAVGPLPAQEAILEAFGQLGYAFRSADL
FT                   ELGHIRGTGQQLPCYQEIEILPPAGHAHAVNEIEVTFIAAPGGLEVVIEADKRAGLFSD
FT                   GHDTVHRFTASHHGVPHTDWNAQVDAWLKEVIAGHETRATPSSGFGHHGDQHRSGPGAG
FT                   AVVAGVAAGVAVGVVGGMVAAEVVDEIGDAFEEEEGEEGDEG"
     atggtgttca agaagttgct cggagccctc ggggtcggtg gaccctcggt cgacaccgtt        60
     ctggagcccg gccccgcact gcccggagcc gtcctcaccg gcgaggtccg cctgcggggc       120
     ggcggatcgg acgtgacggt ggaccggatt tcgctcctcc tcgtcgcccg ggtcgagagg       180
     gaggaccagg acgaggagca cgagggcacg gtcgtcctcg aacggttcac cgtcggcggt       240
     ggattccggc tggcggagga ggccgagcac gcggtgccgt tctccgtcac gctgccgtgg       300
     gagacgccga tcaccgagct ccacggtcag cacctcggcc ccgtgctcgg catccgcacg       360
     gagctggaga tcgcgggagc gcgggacaag ggcgacctgg acgcgctcgc ggtgggaccg       420
     ctgcccgcgc aggaagcgat tctggaggcc ttcgggcagc tcggttacgc gttcaggtcg       480
     gccgacctgg aactcggaca catccggggc accggtcagc aactgccctg ctaccaggag       540
     atcgagattc tccccccggc cggtcacgcg cacgccgtca acgagatcga ggtgaccttc       600
     atcgccgcac cgggcggtct ggaggtcgtg atcgaggcgg acaagcgcgc cggactgttc       660
     tcggacggcc acgacacggt ccaccgcttc accgcctcgc accacggggt cccgcacacc       720
     gactggaacg cccaggtcga cgcctggctg aaggaggtca tcgccggtca cgagacccgt       780
     gcgacgccgt cctcgggctt cgggcaccac ggtgaccagc acaggtcggg tcccggcgcg       840
     ggtgcggtgg tggccggggt cgccgcgggc gtggccgtcg gtgtcgtcgg aggcatggtc       900
     gccgccgagg tcgtcgacga gatcggtgac gccttcgagg aagaggaggg cgaggagggc       960
     gacgagggct ga                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page