(data stored in ACNUC7421 zone)

EMBL: AP009493.PE3

AP009493.PE3         Location/Qualifiers
FT   CDS_pept        complement(4042..4353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_3t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_3t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16832"
FT                   /db_xref="UniProtKB/TrEMBL:B1VKK1"
FT                   /protein_id="BAG16832.1"
FT                   /translation="MTTPSSTAAPAPFGWCHWHKGPSGTAVMVDIVEQKSGPGAALYAC
FT                   APCREQRGLTPVAEQAHEVAYRDYLIHTTDCAGCSRLGRCDLGGRLRDVYQKALDGTR"
     atgaccacac catcgagcac agcagcgccc gcgccgttcg gctggtgcca ctggcacaaa        60
     ggcccgtcgg ggaccgctgt catggtcgac atcgttgagc agaaatcggg ccccggggct       120
     gccctgtacg cgtgcgcccc atgccgggag cagcgcggcc tgactcctgt tgccgagcag       180
     gctcatgagg tggcctaccg ggactacctg atccacacga cggactgcgc cgggtgcagc       240
     cggctaggcc ggtgcgacct cgggggccgg ctccgcgacg tctaccagaa ggccctggac       300
     ggcactcgct ga                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page