(data stored in ACNUC7421 zone)

EMBL: AP009493.PE30

AP009493.PE30        Location/Qualifiers
FT   CDS_pept        34981..35865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_30t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_30t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16859"
FT                   /db_xref="InterPro:IPR005506"
FT                   /db_xref="UniProtKB/TrEMBL:B1VKN3"
FT                   /protein_id="BAG16859.1"
FT                   /translation="MVLLMKALKLLGPWHQEAAARALSGTDQDVLDYLRTRWKEANHND
FT                   IRQRVVELSTQSPYTSVRTVATEVLSGTPAQSPYTSVRTVATEVLSGTPAQIEAFYTDG
FT                   QYEAGIDDMKVDVARLTSTGGPGVAEAAKAALRNGSALALAKFLKIGQYGEHITDERVT
FT                   AARLTNTGGPEVVAAATTALAGDSGQAQAVSAVPGCVVADPAADLAANGLRLPASDPAG
FT                   RVRRPRTVRGRGTRLACVHPGPAAEPSRGRADESEPEPGASGVHRAGSGATRAPGVRAG
FT                   RGVRPAGGSAGAG"
     atggtcctcc tcatgaaggc cctgaaactt ctcgggccct ggcaccagga ggcagccgcc        60
     cgcgcgctct ctggaaccga ccaggatgtc ctggactacc tccgcacgcg ctggaaggaa       120
     gccaaccaca acgatatccg ccagcgagtc gtcgagctga gcacacagag cccctacacc       180
     tcggttcgca ccgtagcaac agaagtcctc agcggcacgc cggcacagag cccctacacc       240
     tcggttcgca ccgtagcaac agaagtcctc agcggcacgc cggcacagat cgaagccttc       300
     tacaccgacg gccagtacga ggccggcatc gacgacatga aggtcgacgt cgcccggctg       360
     accagcacag gcggaccagg cgttgccgag gcggccaagg ccgcgctccg caacggatcc       420
     gccctggccc tcgccaagtt cctgaaaatc gggcagtacg gcgaacacat caccgacgaa       480
     agggttaccg ccgcacgcct gaccaacacc ggagggccgg aggtagtcgc agctgctaca       540
     accgctctcg ccggcgacag cggccaagca caggctgtat cagcggtacc tggatgcgtg       600
     gtggccgatc ctgctgcaga cctcgcagcg aacgggcttc gccttcccgc gagtgaccct       660
     gctggacgcg ttcgccggcc ccggacggta cgaggccggg gaacccggct cgcctgtgtt       720
     catcctggac cggctgctga accatcacgc ggtcgagcgg atgaatctga gccggagccg       780
     ggtgcatctg gtgttcatcg agcgggatcc ggcgcgacac gagcacctgg tgtccgagct       840
     ggtcgcggtg ttcggcccgc tggaggatct gccggtgcgg gttga                       885
//

If you have problems or comments...

PBIL Back to PBIL home page