(data stored in ACNUC7421 zone)

EMBL: AP009493.PE300

AP009493.PE300       Location/Qualifiers
FT   CDS_pept        330872..332209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_300"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_300"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17129"
FT                   /db_xref="GOA:B1VNV6"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNV6"
FT                   /protein_id="BAG17129.1"
FT                   /translation="MSEVALLLLALALTLACAVFVAAEFSLTTVERSELERAVRAGERG
FT                   AESALKAAKRLTFQLSGAQLGITVTSLVIGMLAEPSLAVLLRGPLEGAGLPSGAVSTVA
FT                   TLLGVAASTVVLMVIGELVPKNWAISSPLTVAKVVSTPQRAFTACFAPLIRHLNNSANR
FT                   FVRRLGLEPAEELASARTPQELIALAQHSAREGAIEQDSAELFVRTLHLAELSAENVMT
FT                   PRVDVRALEAHATAADAANLTLATGLSRFPVYRDSLDEVIGTVHIRDVLALDESERGRT
FT                   PVTALATEPLLVPDSLPVDRLLAQLRKRRTMAVVIDEYGGTAGVATVEDIVEEVVGEVR
FT                   DEHDPHERPDLAPAEPLGDGRPVWEAEGSIRLDQLDRIGFGAPEGPYETLAGLLANQLA
FT                   RIPVRTDRVEVDGWQFDVLDIEHHRADRVRITAPAPAPALVEEDAR"
     gtgagcgaag tggcccttct tctcctcgcc ctcgcgctga cgctggcctg cgcggtgttc        60
     gtcgcggccg agttctcgct caccaccgtc gagcgcagcg agctcgaacg cgccgtgagg       120
     gccggggagc gcggtgccga gagcgcgctc aaggcggcca agcgactcac cttccagctc       180
     tccggcgccc agctcggcat caccgtgacc tccctggtca tcggcatgct ggccgagccg       240
     tccctcgcgg tgctgctgcg cggcccgctg gagggcgccg ggcttccgtc cggtgccgtg       300
     tccacggtcg ccacgcttct cggtgtggcc gcctccaccg tggtcctcat ggtcatcggc       360
     gagctggtcc cgaagaactg ggcgatctcc agcccgctca cggtggccaa ggtcgtctcg       420
     accccgcagc gggccttcac ggcctgtttc gctccgctga tccggcacct caacaactcc       480
     gcgaaccgtt tcgtgcgccg cctgggcctg gagccggccg aggagctggc ctccgcccgt       540
     acgccgcagg aactgatcgc gctcgcccag cactccgccc gcgagggcgc catcgagcag       600
     gattcggccg agctgttcgt ccgtaccctg cacctggcgg agctgtccgc agagaacgtg       660
     atgacgccgc gcgtcgacgt ccgtgcgctg gaggcccacg ccaccgccgc cgatgccgcg       720
     aacctcacgc tggccaccgg cctgtcccgc ttcccggtct accgggacag cctggacgag       780
     gtcatcggca cggtccacat ccgcgatgtg ctcgccctgg acgagtccga gcggggccgg       840
     accccggtca cggccctggc gaccgagccg ctcctggtgc ccgactccct gcccgtcgac       900
     cggctgctcg cgcagttgcg caagcgccgg acgatggccg tggtgatcga cgagtacggc       960
     ggtacggcgg gggtcgccac cgtcgaggac atcgtcgagg aggtcgtcgg cgaggtccgc      1020
     gacgagcacg acccccacga gcgccccgac ctcgcaccgg ccgagccgct cggcgacggg      1080
     cgcccggtct gggaggccga gggcagcatc aggctggacc agctcgaccg gatcggcttc      1140
     ggcgcgccgg agggccctta cgagacgctc gccggcctgc tcgccaacca actggcccgc      1200
     attcccgtcc gcacggaccg ggtggaggtc gacggctggc agttcgacgt gctcgacatc      1260
     gagcaccacc gggccgaccg ggtccggatc accgcgccgg cgccggcgcc cgccctcgtg      1320
     gaggaggacg cccgatga                                                    1338
//

If you have problems or comments...

PBIL Back to PBIL home page