(data stored in ACNUC7421 zone)

EMBL: AP009493.PE306

AP009493.PE306       Location/Qualifiers
FT   CDS_pept        complement(335600..337276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_306"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_306"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17135"
FT                   /db_xref="GOA:B1VNW2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNW2"
FT                   /protein_id="BAG17135.1"
FT                   /translation="MSHPTAPGASVAASNLTFRWPDGTHLFDGLSLTVPRGRTGLAGAN
FT                   GAGKSTLLRLFAGLLRPSQGSVTVGGNLAHLPQNITLDTSLRVDAALGIGERRAALRAI
FT                   ESGDVREEHFETVGDDWDVEERALATLGSLGLGAVELDRTVGQLSGGETVLLRLAALLL
FT                   ERPDVLLLDEPTNNLDLFARRRLYDAVDSWRTGILIVVSHDRDLLERVDRIAELRSGSV
FT                   SWYGGGWSAYQEALATQQEAAGRMLRAADADVRRQQRELEETRIKVARRQRHDKKLDGQ
FT                   RKAPRIVAGERKRSAQESGDRLRGLHEDRLDEARERREEAAEAVRRDAEIKVSLPHTAV
FT                   PSGRTVLTVRDLSLPYGRLREGSLHVQGPERVALVGRNGAGKTTFLRTLTGELPPSTGE
FT                   ATTAVPLKFLPQRLDVLDDALSVADNVARTAPGTTDNQIRSQLARFLFKGARAEQPAGT
FT                   LSGGERFRAALAATMLAAPAPQLLLLDEPTNNLDLASVRQLTSALESYEGALVIASHDL
FT                   PFLDSVGITRWVLLDDTLRETDAEEVRALFGNPESTPAGTA"
     atgagccatc ccaccgcgcc cggcgcatcc gtggcggcct ccaacctcac cttccgatgg        60
     cccgacggca cgcacctctt cgacgggctc tccctcaccg tcccccgcgg ccgcaccggt       120
     ctggccggag ccaacggcgc cggcaagtcg acgctgctgc gcctgttcgc cggactgctg       180
     cgtccctcgc agggatccgt cacggtcggc ggaaacctcg cccacctgcc gcagaacatc       240
     accctggaca cctccctgcg cgtcgacgcg gccctcggga tcggagagcg ccgggccgcc       300
     ctgcgcgcca tcgagtccgg agacgtccgc gaggagcact tcgaaacggt cggcgacgac       360
     tgggacgtcg aggagcgcgc cctggccacc ctcggctccc tcgggctcgg cgccgtcgaa       420
     ctggaccgca ccgtcggtca gctgtccggc ggtgagaccg tgctgctgcg cctggccgcg       480
     ctgctgctgg agcgcccgga cgtcctcctc ctcgacgagc cgaccaacaa cctggacctg       540
     ttcgcgcgcc gcaggctcta cgacgccgtc gactcctggc gtaccggcat cctgatcgtc       600
     gtcagccacg accgggacct gctggagcgg gtcgaccgca tcgccgaact gcggtcgggc       660
     tcggtcagct ggtacggggg cggctggtcc gcctaccagg aggccctggc cacccagcag       720
     gaggccgccg ggcggatgct gcgcgccgcc gacgccgacg tacgccgcca gcagcgcgaa       780
     ctggaggaga cccggatcaa ggtcgcccgc cgccagcgcc acgacaagaa gctggacggt       840
     cagcggaagg ccccgcgcat cgtcgccggg gaacgcaagc ggtcggccca ggagtccggg       900
     gaccggctgc gcggcctgca cgaggaccgg ctcgacgagg cccgcgagcg cagggaggaa       960
     gccgccgaag ccgtccgccg ggacgccgag atcaaggtga gcctgcccca taccgcggtg      1020
     ccctcgggcc gcaccgtcct gaccgtgcgg gacctgagcc ttccctacgg acggctgcgc      1080
     gagggcagcc tccatgtgca gggacccgag cgcgtcgccc tggtcggccg caacggggcc      1140
     ggcaagacca cgttcctgcg gacgctcacc ggagagctcc cgccgagcac aggggaggcc      1200
     acgaccgcgg tgccgttgaa gttcctcccg cagcggctgg acgtcctcga cgacgcactg      1260
     agcgtcgccg acaacgtcgc ccgcaccgcc ccgggcacca ccgacaatca gatccgctcc      1320
     cagctcgccc ggttcctctt caagggagcc cgcgcggagc agccggcggg caccctgtcg      1380
     ggcggcgaac gcttccgggc cgccctcgcc gcgacgatgc tcgccgcccc cgccccgcag      1440
     ctgcttctgc tggacgagcc gacgaacaac ctcgatctgg ccagtgtgcg ccagctgacg      1500
     agcgccctgg agtcctacga gggcgcgctc gtcatcgcca gccacgacct gcccttcctg      1560
     gactccgtgg gcatcacccg ctgggtgctg ctggacgaca cgctgcgtga gaccgatgcc      1620
     gaagaggtcc gagccctgtt cggcaacccg gaatcgaccc ctgcgggcac ggcgtga         1677
//

If you have problems or comments...

PBIL Back to PBIL home page