(data stored in ACNUC7421 zone)

EMBL: AP009493.PE307

AP009493.PE307       Location/Qualifiers
FT   CDS_pept        complement(337585..339042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_307"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_307"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17136"
FT                   /db_xref="GOA:B1VQ35"
FT                   /db_xref="InterPro:IPR018584"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ35"
FT                   /protein_id="BAG17136.1"
FT                   /translation="MAIVAGGWFAGKLPVHDPWGWWTDHGSAAKAAAAVLTYVGLTVLV
FT                   VAWWQYGKTASTVRETLVTLAWWTAPFLLAPPLYSADVYSYIAQGSMVLEGHDVYTVGP
FT                   SALDPGGIGGDAAASVGNHWRDTPAPYGPLFLLVSAAVARITGGTIVPAVLAMRLVALV
FT                   SLALIVWSLRRLAREHGRSESRALWLGALNPLLLMHVVGGMHNDGLMIGLMLAGLVLAL
FT                   RGRWIAGSALVGLAMMVKSPAAVALLFIGVLVHASATGPQWRRWAKGLLAPGLIAGAVA
FT                   GGATLISGTGFGWLRTQGVAANIHTALSVTSDIGLGLGELARLLLGVDADPVKSAVQTL
FT                   GLAVAVGVIVALARRAMRGGMTPAHALGLSLLVLVALSPMVQPWYLLWGMAVVAATDRY
FT                   GRLWAVLIVLSAALVYETHPMGATPPYGFVLAGLAAVLGTFALRRTPVVPPGARLPGGR
FT                   GPADPPGSVEDRDPSASTASPAPQSAP"
     gtggcgatcg tcgccggcgg ctggttcgcc ggaaagctgc cggtccacga cccctgggga        60
     tggtggaccg accacgggtc cgctgcgaag gcggccgcgg ccgttctcac gtacgtcgga       120
     ctgaccgtgc tcgtcgtggc ctggtggcag tacggcaaga cggcctccac cgtccgcgaa       180
     acgctcgtca ccctggcctg gtggacggcc ccgttcctgc ttgcgccgcc gctctacagc       240
     gccgacgtct acagctacat cgcccagggc tcgatggtcc tcgaagggca cgacgtctac       300
     accgtcggcc cctccgccct ggaccccggc ggaatcggcg gcgacgccgc cgccagcgtc       360
     ggaaaccact ggcgggacac cccggccccg tacggaccgc tctttctgct cgtctccgcg       420
     gccgtcgccc ggatcaccgg cggcaccatc gtccccgccg tcctggcgat gcggctcgtc       480
     gcgctcgtct ccctcgccct gatcgtctgg tcgctgcgcc gcctggcgcg cgaacacggc       540
     cgcagcgaga gccgcgccct gtggctgggg gcgctcaacc cgctgctgct gatgcacgtg       600
     gtcggcggca tgcacaacga cgggctgatg atcggcctga tgctcgccgg cctggtcctc       660
     gcgctgcgcg gccggtggat cgcgggcagc gccctggtgg gcctcgcgat gatggtcaag       720
     tccccggcgg ccgtggctct cctgttcatc ggggtcctcg tgcacgcgtc cgcgaccggc       780
     ccccagtggc gccgctgggc caagggactg ctcgcacccg gcctgatcgc cggcgcggtg       840
     gccggcgggg ccacgctgat cagcggcacc ggattcggat ggctccgcac ccagggcgtc       900
     gcggcgaaca tccacaccgc gctctccgtc accagcgaca tcggcctcgg actgggagag       960
     ctggcccgac tgctcctggg cgtcgacgcg gacccggtca agtccgccgt ccagaccctg      1020
     ggcctggccg tcgcggtcgg cgtgatcgtc gcactggccc ggcgcgcgat gcggggcggc      1080
     atgacgccgg cccacgccct gggactctcc ctgctcgtcc tggtggccct ctcacccatg      1140
     gtccagccct ggtacctgtt gtggggcatg gccgtcgtcg ccgccaccga ccggtacggt      1200
     cgcctctggg cggtcctgat cgtgctctcg gcggcactgg tgtacgagac ccatcccatg      1260
     ggcgccaccc cgccctacgg attcgtcctc gccggactcg ccgccgtcct cggcaccttc      1320
     gcgctccggc gtacccccgt cgtaccgccc ggcgcccgac tgcccggtgg acggggcccc      1380
     gctgacccgc cgggctcggt ggaggaccgg gacccctccg cgtccaccgc ttcgcccgcc      1440
     ccgcagagtg ctccctga                                                    1458
//

If you have problems or comments...

PBIL Back to PBIL home page