(data stored in ACNUC7421 zone)

EMBL: AP009493.PE308

AP009493.PE308       Location/Qualifiers
FT   CDS_pept        complement(339381..339650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_308"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_308"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17137"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ36"
FT                   /protein_id="BAG17137.1"
FT                   /translation="MDELMRQRRVYGTDHDDPRPGPRPGHDYRELVGGPLDGLLLDVTG
FT                   WGEADLRDGVGLVTEIGAYGPGGRAEYGPRSPDSHQWDWRGDVR"
     atggacgagc tgatgaggca gcgacgggtg tacggcaccg accacgacga cccccgcccc        60
     gggccgaggc cgggtcacga ctaccgcgag ctggtcggcg gcccgctcga cgggctcctg       120
     ctcgacgtca ccggctgggg cgaggcggat ctgcgcgacg gcgtcgggct ggtcaccgag       180
     atcggcgcct acggacccgg aggacgcgcc gagtacggac cgaggtcgcc ggacagccac       240
     cagtgggact ggcgcggcga cgtccggtga                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page