(data stored in ACNUC7421 zone)

EMBL: AP009493.PE309

AP009493.PE309       Location/Qualifiers
FT   CDS_pept        339776..340396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_309"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_309"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17138"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ37"
FT                   /protein_id="BAG17138.1"
FT                   /translation="MILPPRLIPLLDQFDFACERLLARLSGPAMDSGNGVEIGVTPLGD
FT                   DEHLWEPVPDCWSVRRRGDAPGARATVLAGAGAWGRDAAESPHPFPPPFTTIAWRLSHL
FT                   AEMLTLRADHTSGGRTLTRDGYRTPGDAAGAVAAFGTASAAWREALLTADDTALDTIGY
FT                   STYPNGSDAEDPFVDIVWWVNQEVLHHGAEIALLRDLYRARPT"
     atgatcctcc caccgcggct gatcccgctg ctggaccagt tcgacttcgc ctgcgagcgg        60
     ctcctcgccc gcctgtccgg tcccgccatg gacagcggca acggcgtcga gatcggcgtc       120
     accccgctcg gtgacgacga gcacctctgg gaacccgtgc ccgactgctg gtccgtacgc       180
     cgtcgcggcg acgcccccgg ggcgcgggcg accgttctgg cgggagccgg cgcctggggc       240
     cgagacgcgg cggaatcccc gcatccgttc cctccgccgt tcaccaccat cgcgtggcgt       300
     ctgagccatc tcgccgaaat gctcaccctg cgtgccgacc acacctctgg cggcaggacg       360
     ctcacgcgtg acggctaccg cactccgggg gacgccgccg gggccgtggc cgccttcggg       420
     accgcgtccg ccgcctggcg cgaagccctg ctcaccgccg acgacacggc cctggacacc       480
     atcgggtaca gcacgtatcc gaacggcagc gacgcggagg atccgttcgt cgacatcgtc       540
     tggtgggtca accaggaagt gctgcaccac ggcgccgaga tcgcgctgct ccgcgatctg       600
     taccgagcca ggccgacctg a                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page