(data stored in ACNUC7421 zone)

EMBL: AP009493.PE31

AP009493.PE31        Location/Qualifiers
FT   CDS_pept        35633..36628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_31t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_31t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16860"
FT                   /db_xref="InterPro:IPR031009"
FT                   /db_xref="UniProtKB/TrEMBL:B1VKN4"
FT                   /protein_id="BAG16860.1"
FT                   /translation="MTLLDAFAGPGRYEAGEPGSPVFILDRLLNHHAVERMNLSRSRVH
FT                   LVFIERDPARHEHLVSELVAVFGPLEDLPVRVEVRRGEAGKDSLPVLTELGAWGNPILG
FT                   IFDSWGSVNVPLKVMARIARNRSSEVITTFGPNWFSRREELNADLLDTVFGGRGFWMPA
FT                   ADEARSDERWRAWLGTYRNALKRAGFGYQLQFQLVPRTGQPLYLVFGTGSDAGLRAMKD
FT                   AMWKVDDRDGESFRDPRNRGGAVAGQIDLFQMEETLDPELVELVTQRLERGDVTVEAVG
FT                   RWLLTETSRWMSTHALKAARVMRQDGSLVVQSAGKLTNKSVVGLPAPVRS"
     gtgaccctgc tggacgcgtt cgccggcccc ggacggtacg aggccgggga acccggctcg        60
     cctgtgttca tcctggaccg gctgctgaac catcacgcgg tcgagcggat gaatctgagc       120
     cggagccggg tgcatctggt gttcatcgag cgggatccgg cgcgacacga gcacctggtg       180
     tccgagctgg tcgcggtgtt cggcccgctg gaggatctgc cggtgcgggt tgaagtacgc       240
     cgtggggagg ccgggaagga cagcctgccg gtcctgaccg agctgggcgc gtggggcaac       300
     ccgatcctgg gaatcttcga cagctggggc agcgtgaacg tgccgctgaa ggtgatggca       360
     cggatcgccc gcaatcggtc cagtgaggtg atcacgacct tcgggccgaa ctggttcagc       420
     cgccgcgagg agctgaacgc ggacctcctc gacaccgtct tcggcggccg cggcttctgg       480
     atgccggccg ccgacgaagc tcggtctgac gaacgctggc gagcttggct gggtacctac       540
     cgcaacgccc tgaaacgggc cgggttcggc taccaactgc agttccagct cgtgccgcgt       600
     accgggcagc cgctctacct ggtcttcggc accggaagcg atgctggcct gcgggcgatg       660
     aaggacgcga tgtggaaggt cgacgaccgc gacggtgaga gcttccggga cccacgcaac       720
     cgcggcggcg cggtcgccgg acagatcgac ctgttccaga tggaggagac cctcgacccc       780
     gagctcgtgg aactcgtcac ccagcgcctg gagcgcggtg acgtcacggt ggaagcggtg       840
     ggccggtggc tgctgaccga gaccagccgc tggatgtcca cccacgccct caaggcggcc       900
     cgggtgatgc gccaggacgg gtccctggtc gtccagtcgg ccgggaagct gaccaacaag       960
     agtgtggtgg gtctgccggc tcccgtgagg tcctga                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page