(data stored in ACNUC7421 zone)

EMBL: AP009493.PE310

AP009493.PE310       Location/Qualifiers
FT   CDS_pept        340504..341337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_310"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17139"
FT                   /db_xref="GOA:B1VQ38"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ38"
FT                   /protein_id="BAG17139.1"
FT                   /translation="MNRRRTPRSASAEDLLNTLQDLTARARREVEFHQARVELAQALQR
FT                   DMLPAALPAVPGLQSAARYAPARHGLDIGGDWYDGFPLADGALGFAIGDVQGHDVEAAA
FT                   FMGQVRIAMRAIAGTASDPGEILGRTNDLLVSVDSGLFATCTFMRLDPATWELHSARAG
FT                   HVACVWATTEGRSGVTEDPGGLPLGIEPGEGYPVTRRTLDSDGAIVLLTDGVVEGPSLR
FT                   IEDGLERVRGLVAAHAGSSAGRLADEVLGAAEVTGHEDDAAVLVLRHAAAHRGPR"
     atgaaccggc gtcggactcc ccgctcagct agcgccgaag acctgctcaa caccctgcag        60
     gacctcaccg cccgcgctcg gcgcgaggtg gagttccacc aggccagggt ggagttggcg       120
     caggcgctcc agcgcgacat gctgcccgcg gccctgcccg cggtccccgg tctccagtcc       180
     gcggcccgct acgcaccggc ccgccacggc ctggacatcg gcggcgactg gtacgacggt       240
     ttcccgctcg cggacggggc cctcggcttc gccatcggcg acgtgcaggg gcacgacgtc       300
     gaggccgccg ccttcatggg gcaggtccgt atcgcgatgc gggccatcgc gggcaccgcg       360
     tccgatccgg gagagatcct cggcaggacg aacgacctgc tggtgtccgt cgactcgggt       420
     ctcttcgcga cctgtacgtt catgcgcctg gacccggcga cctgggaact gcacagtgcg       480
     cgggccgggc acgtggcctg cgtgtgggcc accacggagg ggcggtccgg cgtgacggag       540
     gatccgggcg gcctgccgct gggcatcgag ccgggcgagg gttatcccgt cacccgccgc       600
     accctcgact ccgacggtgc gatcgtgctg ctgaccgacg gggtcgtcga gggcccctcg       660
     ctgcggatcg aggacggtct ggagcgtgta cgcgggctgg tcgccgcgca cgcggggtcg       720
     agcgcgggtc ggctggccga cgaggtgctg ggcgcggcgg aggtgacggg gcacgaggac       780
     gacgccgccg tcctggtcct gcggcatgcc gccgcgcacc gcggaccgcg gtga             834
//

If you have problems or comments...

PBIL Back to PBIL home page