(data stored in ACNUC7421 zone)

EMBL: AP009493.PE311

AP009493.PE311       Location/Qualifiers
FT   CDS_pept        341393..342427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_311"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_311"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17140"
FT                   /db_xref="GOA:B1VQ39"
FT                   /db_xref="InterPro:IPR007895"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ39"
FT                   /protein_id="BAG17140.1"
FT                   /translation="MSGVIRTERARHRAMYVAQILGVAGAYYLVGHLGLMRQVVVDGAV
FT                   VTPLWPPTGIALASLLCLGVRVWPGIALGTLVTVSEIGDAFTVSRLAIMLGNTLAPLVS
FT                   CALLRRVGFRSELVRLRDGICLVFLGAFAGMLISATIGSVTLLLDDKVPPGRFWLVWSS
FT                   WWAGDAMGVLVVTPLLLVLRRVRWPRPSDRWLEASLLAAVAVTVSLIATRSSLSMVYLV
FT                   FPVIIWAALRFQLPGSAPCALVVSVLAIIAGTDAVGPFAGHSLMEIMANLTLLNASVAL
FT                   TALLLGAVVAEHRNIRRETEYAVEELEALVEQLAPLSGPGAARYGDRERRHGPLDGGPH
FT                   PDPQ"
     atgagtggtg tgatccgcac cgaaagagcc agacaccggg ccatgtacgt ggcgcagatc        60
     ctgggtgtgg ccggcgccta ctacctggtg ggacatctcg ggctgatgcg ccaggtcgtc       120
     gtggacggcg cggtcgtcac gcccctgtgg ccgcccaccg gcatcgccct ggcctcgctg       180
     ctgtgcctgg gcgtccgtgt ctggccgggc atcgcgctgg gaacgctggt cacggtctcc       240
     gagatcggcg acgcgttcac cgtgagccgt ctggccatca tgctcggcaa cacgctcgcc       300
     ccgctcgtct cctgcgccct gctgcggagg gtcggcttcc gtagcgagct ggtccggctc       360
     cgggacggga tctgcctggt cttcctcggc gcgttcgccg gaatgctgat cagcgccacc       420
     atcgggagtg tcacgctgct gctcgacgac aaggttccgc cgggacggtt ctggctggtc       480
     tggtcgtcct ggtgggcggg ggacgcgatg ggggtcctgg tggtcactcc cctgctgctg       540
     gtcctgcgca gggttcgatg gccccggccg tccgaccggt ggctggaggc ttcgctgctc       600
     gcggccgtcg cggtcacggt gtcgctgatc gccacgcgca gctcgctgtc gatggtctat       660
     ctggtcttcc cggtgatcat ctgggcggct ctgcgcttcc aactgccggg cagcgctccc       720
     tgcgccctgg tcgtctcggt gctcgccatc atcgccggta cggatgccgt gggaccgttc       780
     gccgggcaca gcctgatgga gatcatggcc aatctgaccc tgctcaacgc gagcgtcgcg       840
     ctcaccgcgc tgctgctcgg ggccgtcgtc gcggagcaca ggaacatccg ccgcgagacc       900
     gaatacgccg tcgaggagct ggaagccctg gtggagcagt tggcacccct gtcggggccg       960
     ggtgcggcgc ggtacgggga ccgcgaacgg cggcacgggc cgctcgacgg cggccctcac      1020
     ccggaccccc agtag                                                       1035
//

If you have problems or comments...

PBIL Back to PBIL home page