(data stored in ACNUC7421 zone)

EMBL: AP009493.PE312

AP009493.PE312       Location/Qualifiers
FT   CDS_pept        342740..342934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_312"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_312"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17141"
FT                   /db_xref="InterPro:IPR028037"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ40"
FT                   /protein_id="BAG17141.1"
FT                   /translation="MSALDKIKKMLKGHEQQVGKGIDKAGDMVDDRTQGKYKGHVDTGQ
FT                   DRLKQQFGADRDQDGPPRA"
     atgtccgcac tggacaagat caagaagatg ctcaagggcc acgagcagca ggtcggcaag        60
     ggcatcgaca aggccggcga catggtcgac gaccgcaccc agggcaagta caaggggcac       120
     gtcgacaccg gtcaggacag gctcaagcag cagttcgggg cggaccgcga ccaggacggg       180
     ccgccccgcg cctga                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page