(data stored in ACNUC7421 zone)

EMBL: AP009493.PE314

AP009493.PE314       Location/Qualifiers
FT   CDS_pept        344872..345249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_314"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_314"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17143"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ42"
FT                   /protein_id="BAG17143.1"
FT                   /translation="MIAQVECVALDCPDPKELAGFYLSLLGGEVDRTDRRWACDADWST
FT                   LHTPGGLVLAFQRVADHRPPGWPGQDPPQQFHLDFGVTDQEEAHEVVLACGGSVLDAGD
FT                   EARGWRVYADPAGHPFCLVRH"
     atgatcgctc aagtggagtg cgtggcactg gactgcccgg acccgaagga actggccggc        60
     ttctacttgt ccttgctcgg gggcgaggtc gaccgcaccg accggagatg ggcgtgcgac       120
     gcggactggt ccacgctgca cacccccggt ggcctcgtcc tcgcctttca gcgggtggcc       180
     gaccaccgcc cgcccggctg gcccggtcag gatccgcccc agcagttcca cctggacttc       240
     ggcgtcaccg accaggagga ggcgcacgag gtggtcctgg cgtgcggggg ttccgtgctc       300
     gacgccgggg acgaggcacg cgggtggcgt gtgtacgccg accccgccgg gcaccccttc       360
     tgcctggttc ggcactga                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page