(data stored in ACNUC7421 zone)

EMBL: AP009493.PE315

AP009493.PE315       Location/Qualifiers
FT   CDS_pept        complement(345343..345684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_315"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_315"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17144"
FT                   /db_xref="GOA:B1VQ43"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ43"
FT                   /protein_id="BAG17144.1"
FT                   /translation="MKPEKDCARGLAQLEGFLLWNAEIERARRQARLFTHQLPWLTTAQ
FT                   REDVERVFIAERVAASRESLIRVRDRADELREEYTGRYARLRVRCVAVSAGAVGAATCL
FT                   GTVLMLALR"
     gtgaaacccg agaaggactg cgcccgcggc ctggcgcaac tggagggctt tctgctgtgg        60
     aacgcggaga tcgagcgggc gcgacgacag gcgcgcctct tcacccacca actgccctgg       120
     ctgaccaccg ctcagcgtga ggacgtcgag cgggtgttca tcgccgagcg cgtcgccgcg       180
     tcccgggagt cgctcatccg cgtccgggac cgcgcggacg aactgcgcga ggagtacacc       240
     gggcgctacg cccggctccg ggtccgctgc gtcgccgtct cggccggtgc ggtgggggcg       300
     gcgacctgcc tcggtacggt gctgatgctg gccctgcgct ga                          342
//

If you have problems or comments...

PBIL Back to PBIL home page