(data stored in ACNUC7421 zone)

EMBL: AP009493.PE316

AP009493.PE316       Location/Qualifiers
FT   CDS_pept        complement(345734..347542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_316"
FT                   /product="putative cytochrome c oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_316"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17145"
FT                   /db_xref="GOA:B1VQ44"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ44"
FT                   /protein_id="BAG17145.1"
FT                   /translation="MSHRTDLRGSILVAESTRAVDRRSVVVTTRGISQSVETDTADQDE
FT                   MPVRRGEPGNVVVKWMTTTDHKTIGTLYLVTSFAFFCVGGLMALVMRAELARPGIQLIS
FT                   NEQFNQAFTMHGTIMLLMFATPLFAGFANWIMPLQIGAPDVAFPRLNMFAYWLYLFGSL
FT                   IAVAGFLTPQGAADFGWFAYSPLNDAVRSPGIGADMWIMGLAFSGFGTILGSVNFITTI
FT                   ICMRAPGMTMFRMPIFVWNVLLTGVLVLLAFPVLAAALLALEADRKFGAHVFDAANGGA
FT                   LLWQHLFWFFGHPEVYIIALPFFGIVTEILPVFSRKPVFGYIGLVAATIAIAGLSATVW
FT                   AHHMFVTGGVLLPFFSFMTFLIAVPTGVKFFNWIGTMWKGSLSLETPMLWSVGFLVTFL
FT                   FGGLTGIILASPPLDFHVSDSYFVVAHFHYVVFGTVVFAMFAGFHFWWPKFTGKMLDER
FT                   LGKMTFWTLFVGFHGTFLVQHWLGAEGMPRRYADYLEADGFTALNTISTISSFLLGLSI
FT                   LPFFYNIWKTAKYGRKIEVDDPWGYGRSLEWATSCPPPRHNFVTLPRIRSESPAFDLHH
FT                   PDVRSLEQVTNRPQNSTIVAPGDQHE"
     atgtcccacc gcaccgatct ccgcgggtcc atcctggtcg ccgagtccac acgggccgtc        60
     gatcgaagga gcgtcgtagt gacgacgagg ggcatctcgc aatcggtgga gaccgatacc       120
     gccgaccagg acgaaatgcc ggtacggcgc ggcgaacccg gcaacgtggt cgtcaaatgg       180
     atgaccacca cggaccacaa gacgatcggc acgctctacc tcgtcacctc cttcgcgttc       240
     ttctgcgtcg gtgggctcat ggcgctggtg atgcgagccg agctggcccg gcccggcatc       300
     caactgatct cgaacgagca gttcaaccag gcgttcacca tgcacggcac gatcatgctg       360
     ctgatgttcg cgacgccgct gttcgccgga ttcgcgaact ggatcatgcc gctccagatc       420
     ggcgcgcccg acgtggcgtt cccgcggctg aacatgttcg cgtactggct gtacctcttc       480
     ggctcgctca tcgcggtggc gggtttcctc accccgcagg gtgcggcgga cttcggctgg       540
     ttcgcctact ccccgctcaa cgacgcggtc cgctcgcccg gtatcggcgc agacatgtgg       600
     atcatgggtc tggccttctc cggcttcggc acgatcctcg gctcggtcaa cttcatcacc       660
     acgatcatct gcatgcgcgc acccggcatg acgatgttcc gcatgccgat cttcgtctgg       720
     aacgtcctgc tgaccggtgt tctggtcctg ctggccttcc cggtcctcgc cgccgccctg       780
     ctggcgctgg aggccgaccg caagttcggt gcgcacgtct tcgacgcggc caacggcggc       840
     gccctgctgt ggcagcacct gttctggttc ttcggccacc ccgaggtcta catcatcgcc       900
     ctgccgttct tcggcatcgt cacggagatc ctcccggtct tcagccgcaa gccggtgttc       960
     ggctacatcg gcctggtcgc ggccaccatc gccatcgcgg gcctgtccgc gaccgtctgg      1020
     gcgcaccaca tgttcgtcac ggggggagtg ctgctgccgt tcttctcgtt catgaccttc      1080
     ctcatcgccg ttccgaccgg agtgaagttc ttcaactgga tcggcacgat gtggaagggg      1140
     tcgctctccc tggagacccc gatgctctgg tccgtcgggt tcctggtcac cttcctgttc      1200
     ggcggtctga ccgggatcat tctcgcctca ccgcccctgg acttccatgt ctccgactcg      1260
     tacttcgtcg tcgcccactt ccactacgtg gtgttcggca ccgtggtgtt cgcgatgttc      1320
     gccggattcc atttctggtg gccgaagttc accgggaaga tgctggacga gcggctcggg      1380
     aagatgacgt tctggaccct cttcgtcgga ttccacggga cgttcctcgt ccagcactgg      1440
     ctcggtgccg agggcatgcc ccgccgctac gcggattacc tcgaagccga cggtttcacc      1500
     gcgctgaaca cgatctccac catttcctcc ttcctgctgg gcctgtcgat cctgccgttc      1560
     ttctacaaca tctggaagac cgccaagtac ggccggaaga tcgaggtcga cgacccatgg      1620
     ggctacggcc ggtcgctgga atgggccacg tcctgcccgc cgccccgcca caacttcgtc      1680
     accctgccgc ggatccgttc cgaatccccg gcgttcgacc tgcaccaccc ggacgtccgc      1740
     tccctggagc aagtcaccaa ccgtccccag aactccacga tcgtggctcc cggggaccag      1800
     cacgagtga                                                              1809
//

If you have problems or comments...

PBIL Back to PBIL home page