(data stored in ACNUC7421 zone)

EMBL: AP009493.PE318

AP009493.PE318       Location/Qualifiers
FT   CDS_pept        complement(348519..348857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_318"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_318"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17147"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ46"
FT                   /protein_id="BAG17147.1"
FT                   /translation="MIADTRRDRVAGAAAEAAQGVPGVAFLRPGVADLLRNRITERTPR
FT                   RASLTANRTPGVRVGRDEGDGWHIDIRLVLRRGHRALDVTRAVRAAVVAVLPEEPVASL
FT                   RITVTGIV"
     atgatcgcgg acacacgccg ggaccgggtg gccggagctg ccgccgaggc cgctcagggc        60
     gtaccgggcg tcgcgttcct gcgccccggc gtggcggacc tgctgcgcaa ccggatcacc       120
     gagcgcaccc cgcgccgcgc ctcactgacc gcgaacagga caccgggagt gcgggtcggc       180
     cgggacgagg gcgacggctg gcacatcgat atccggctcg tcctgcgccg cggtcaccgg       240
     gcgctcgacg tcaccagggc cgtacgagcc gcggtcgtcg ccgtgctgcc ggaggagccg       300
     gtggcctcgc tgaggatcac ggtcacaggc atagtctga                              339
//

If you have problems or comments...

PBIL Back to PBIL home page