(data stored in ACNUC7421 zone)

EMBL: AP009493.PE319

AP009493.PE319       Location/Qualifiers
FT   CDS_pept        complement(348854..349624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_319"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_319"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17148"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ47"
FT                   /protein_id="BAG17148.1"
FT                   /translation="MSADPDRPEESRLEESQYGESRHDERRYEEEDERLGCGRLLADVW
FT                   EAWDTGRSAEDPHFAPCPFCSAALADLTGLDDAVRRTCEQEPGTPDTTAITARVMDLVR
FT                   LELRPGRPLPLGEPGEDHWMVESAVARILRSAVDSLPGVRAGSCRIAPLDPADPTGDLH
FT                   VRVEVAASVGRPLRDLADAVRARVAEVADRDIGIRLAAIDVLVVDILDTVDTLDVFYEG
FT                   GGHRVYGDGDGEDGTVTGGHANGRADGHGTGATR"
     atgagcgccg atccggacag gccggaggag agccggctgg aggagagcca gtacggggag        60
     agccgacacg acgagcgccg ctatgaggag gaggacgagc gtctcggttg cgggcgcctg       120
     ctcgccgacg tctgggaggc ctgggacacc ggccgctcgg cggaggaccc ccacttcgcc       180
     ccatgcccct tctgctcggc cgctctggcc gacctcacgg gtcttgacga cgcggtgcgc       240
     cgcacctgcg agcaggagcc cgggacaccg gacaccaccg ccataacggc tcgtgtcatg       300
     gacctcgtgc ggctcgaact gcgcccggga cgcccactgc cgctgggaga accgggggag       360
     gaccactgga tggtcgagtc cgcggtcgca cgcatactgc ggtcggcggt cgacagcctg       420
     cccggggtgc gggccgggag ttgccgtatc gcccctctcg accccgcgga cccgaccggt       480
     gatctgcacg tccgggtcga ggtggcggcg agtgtcggcc ggcccctgcg ggacttggcg       540
     gatgccgtgc gcgcacgggt cgccgaggtc gccgaccgtg acatcggtat ccgtctcgcg       600
     gccatcgatg ttctcgtcgt cgacatcctc gacacggtcg acacgctcga cgtcttctac       660
     gagggcggcg gccaccgtgt gtacggcgat ggagacggag aggacggcac ggtcaccggc       720
     ggacacgcga acggccgggc cgacggacac gggacgggag caacgcgatg a                771
//

If you have problems or comments...

PBIL Back to PBIL home page