(data stored in ACNUC7421 zone)

EMBL: AP009493.PE32

AP009493.PE32        Location/Qualifiers
FT   CDS_pept        complement(36707..37474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_32t"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_32t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16861"
FT                   /db_xref="InterPro:IPR011101"
FT                   /db_xref="UniProtKB/TrEMBL:B1VKN5"
FT                   /protein_id="BAG16861.1"
FT                   /translation="MSDRSSIEWTEATWNPTTGCDRVSAGCDNCYALTLSKRLKAMGSP
FT                   KYQNDGDPRTSGPGFGLTVHPQALTVPLRWRAPRTVFVNSMSDLFHARVPLDYVRRVFE
FT                   VMASTPQHTYQVLTKRARRVRQLADRLEWPENLWMGVSVESVKELPRVEDLRQVPAAVK
FT                   FLSCEPLIGPLPGLEVSGIDWVIVGGESGTGARSTDLQWASDIVETCQASGTSVFVKQL
FT                   GSGWNKALHKDIDQFPAALRVREYPRARHGAPA"
     gtgagcgacc gcagttcgat cgagtggacc gaagcgacat ggaacccgac cacgggatgc        60
     gaccgagtgt cggcggggtg tgacaactgc tacgccctga ccctgtcgaa gcggctgaag       120
     gcgatggggt cgccgaagta ccagaacgac ggtgatcccc ggacgtccgg cccggggttc       180
     ggcctgacgg tgcatccgca ggcgctgacc gtcccgttga ggtggcgcgc cccgcgcacg       240
     gtctttgtca actccatgag tgatctcttc cacgcccgag tcccgctgga ctacgtgcgc       300
     cgggtcttcg aggtgatggc ctccactccg cagcacacgt accaggtgct gaccaagcgg       360
     gcccggcggg tgcggcagct cgccgaccgg ctggagtggc ccgagaacct gtggatgggc       420
     gtgtcggtgg agagcgtcaa ggagctgcca cgggtggagg acctgcggca ggttcccgcc       480
     gcggtgaagt tcctgtcgtg cgagccgctg atcgggccgc tccccgggtt ggaggtgtcc       540
     gggatcgact gggtgatcgt cggtggcgag tctggcaccg gcgcccgttc cacggacctc       600
     caatgggcca gcgacatcgt cgagacatgc caggcgtcgg gcacctcggt gttcgtcaag       660
     cagctgggat cgggctggaa caaggcgctc cacaaggaca tcgaccagtt ccccgcagcc       720
     ctgcgggtgc gggagtaccc ccgggcgagg cacggggctc ccgcctga                    768
//

If you have problems or comments...

PBIL Back to PBIL home page