(data stored in ACNUC7421 zone)

EMBL: AP009493.PE321

AP009493.PE321       Location/Qualifiers
FT   CDS_pept        350601..351125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_321"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_321"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17150"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ49"
FT                   /protein_id="BAG17150.1"
FT                   /translation="MTTIQPAATVPSAGTASRTGTTKQSGSASGTTTVGSGATGAAEPA
FT                   ATRGRTSIADTVVVKIAGMAAREIPGVHDMGGGLSRTLGAVRDRVPGGRPNVGRGVKVE
FT                   VGERQTAIDVDLVVEYGVAITDVAHDVRENVIAAVERTTGLEVVEVNVTVNDVHLPEDD
FT                   DEVASSETRVA"
     atgaccacca ttcagccggc agcgaccgtt ccctccgcgg gaacggcttc gcggacgggc        60
     acgacaaagc agagcggctc cgcgagcggg accaccacgg tcggcagcgg ggccaccggg       120
     gcggccgagc cggcggcgac gcggggccgc acctccatcg cggacaccgt cgtcgtgaag       180
     atcgcgggca tggcggcccg cgagatcccc ggcgtccacg acatgggcgg cgggctctcc       240
     cgcaccctcg gcgcggttcg cgaccgggtg ccgggcggcc ggccgaacgt cgggcggggc       300
     gtcaaggtcg aggtgggcga gcgccagacc gccatcgatg tggacctcgt cgtcgaatac       360
     ggcgtcgcga tcaccgatgt ggcgcacgac gtccgggaga acgtcatcgc ggcggtggag       420
     cgcaccacgg gacttgaggt ggtcgaagtc aatgtgacgg tcaacgacgt gcatctgccc       480
     gaggacgacg acgaggtcgc ctcgtccgag actcgcgtgg cgtga                       525
//

If you have problems or comments...

PBIL Back to PBIL home page