(data stored in ACNUC7421 zone)

EMBL: AP009493.PE322

AP009493.PE322       Location/Qualifiers
FT   CDS_pept        351130..351357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_322"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_322"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17151"
FT                   /db_xref="GOA:B1VQ50"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ50"
FT                   /protein_id="BAG17151.1"
FT                   /translation="MTREVDASGGADGRPGWGAYGTAAGMALGFAAWFGGFGAFLMVAS
FT                   LGAVGWFAGHLVDRGTSLREFLDTVAGRRP"
     gtgacgcggg aggtggacgc gtccggcggg gcggacggtc gcccgggctg gggtgcctac        60
     gggacggcgg cgggcatggc gttgggattc gcggcctggt tcggcgggtt cggtgccttc       120
     ctcatggtcg cgtcgctggg cgcggtgggc tggttcgccg ggcacctggt ggaccggggc       180
     accagtctgc gcgagttcct ggacacggtg gcggggcggc ggccatga                    228
//

If you have problems or comments...

PBIL Back to PBIL home page