(data stored in ACNUC7421 zone)

EMBL: AP009493.PE323

AP009493.PE323       Location/Qualifiers
FT   CDS_pept        351354..352412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_323"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_323"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17152"
FT                   /db_xref="GOA:B1VQ51"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ51"
FT                   /protein_id="BAG17152.1"
FT                   /translation="MTVPAAGRGTTTVTPRAVRRIAERAASEALPDGGTVTSGSASVHG
FT                   ASARVKVGVRLPYPLPADEAAERIQERARTRTAALTGLSVPHADVRINSLSVHPLPPAR
FT                   TPSGDEPRGTADAARGARGTVRSGGPGGRIRAQRRIPSALTAAVGAIGCALLLVDVIAV
FT                   RLGDAPAAWRTWLVDWASTHGPADTAVRFGGVLAALTGAWLLGCALLPGQRRRLTMAAP
FT                   APGLRAALDRSAAARVVQDRTAAVGGVVRVLVRVRRRRVKVLAEVGYGAPEQVRAEVVR
FT                   VVQAALPELGLARTPTLRVGIRVRRAPQGPPPSAEKPRQSTTASTTATPTPAPAPAPAP
FT                   APAPAPAQQREV"
     atgacggtcc ccgccgccgg gcgtggtacg acgacggtga ctccccgcgc cgtccggcgg        60
     atcgccgaac gggcggcgtc cgaggcactg ccggacggcg gcacggtgac gagcggctcc       120
     gcttcggtgc atggcgcgtc cgcgcgcgtc aaggtcggcg tccggctgcc ctacccccta       180
     ccggcggatg aagccgccga gcggatccag gagagggccc gtaccaggac tgcggctctg       240
     acgggcctgt ccgttcccca cgcggacgtg cggatcaact cgctctcggt gcatcctctg       300
     ccgcccgccc ggacaccctc gggagatgag ccccgcggga cagccgatgc ggcgcgcggg       360
     gcacggggca ccgtacggag cggtggtccg ggcggccgga tccgggccca gcgccggatc       420
     ccctcggcgc tcacggcggc cgtcggagcc atcggctgtg ctctgctcct ggtggacgtc       480
     atcgcggtcc gtctcggcga cgcccccgcc gcctggcgga cgtggctggt cgactgggcg       540
     tcgacgcacg gcccggcgga cactgcggtc cggttcggcg gggtgctggc agcgttgacc       600
     ggggcatggc tgctggggtg cgccctcctc ccggggcagc gacgccggct gacgatggcc       660
     gcgcccgcgc cggggctgcg ggcggcgctc gaccgttcgg ccgccgcccg ggtcgtccag       720
     gaccgcaccg ctgctgtggg cggagtggtt cgggtcctgg tgcgggtgcg gcggcggcgc       780
     gtcaaggtgc tggcagaggt cggctacggc gccccggagc aggtgcgggc cgaagtggtc       840
     cgggtcgtcc aagcagccct gccggagctg ggtctggcgc ggactcccac tctgcgggtc       900
     gggatccggg tccgacgtgc cccacagggg ccgccgccgt ccgccgagaa gccgaggcaa       960
     tccacgaccg cctcgacgac ggcgacaccg actccggctc cggctccggc tccggctccg      1020
     gctccggctc cggctccggc tcaacagaga gaggtgtga                             1059
//

If you have problems or comments...

PBIL Back to PBIL home page