(data stored in ACNUC7421 zone)

EMBL: AP009493.PE324

AP009493.PE324       Location/Qualifiers
FT   CDS_pept        352417..353007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_324"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_324"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17153"
FT                   /db_xref="GOA:B1VQ52"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ52"
FT                   /protein_id="BAG17153.1"
FT                   /translation="MSVTGRGRVNRSLLGAVGLLLLVCGGWLALGDGSAWVPMVDRVPQ
FT                   WWPTPAPDGVLLDRDLTARLREKGWWSPALITGLALALVLLLWWLAHQARPGRARWSVL
FT                   PRSGPVLRRRAWERAMTTQIAAYDDVARARVRIVGRPPRAVVAVVVEPGSRPAQVVRSV
FT                   AAVIADARDSVGVRSLSADIRVRIVNRRERRTR"
     atgtcggtga cagggcgtgg cagggtcaac cggtcgctgc tcggtgccgt cggactgctg        60
     ctcctggtct gcggtggctg gttggccctg ggcgacggtt cggcgtgggt cccgatggtg       120
     gaccgcgtcc cgcagtggtg gccgacgccc gcgccggacg gggtgttgct ggaccgcgac       180
     ctgacagcac ggctccggga gaaggggtgg tggagccctg ccctgatcac cggactcgct       240
     ctcgctctgg tgctgttgct gtggtggttg gcccatcagg cacggccggg cagagcccgt       300
     tggtcggtcc ttccgcgcag cggaccggtc ctgcgcaggc gtgcctggga gcgggcgatg       360
     acgactcaga tagcggcgta cgacgacgtg gcgcgtgccc gtgtccgtat cgtgggccgg       420
     ccgccgcggg cggtggtggc ggtggtcgtg gagcccgggt cccggccggc acaggtcgtg       480
     cggtccgtgg ccgcggtcat cgcggacgcc cgcgacagtg tcggcgtgcg gagcctctcg       540
     gccgacatcc gggtccggat cgtgaaccgg cgggagcggc ggacgcgttg a                591
//

If you have problems or comments...

PBIL Back to PBIL home page