(data stored in ACNUC7421 zone)

EMBL: AP009493.PE325

AP009493.PE325       Location/Qualifiers
FT   CDS_pept        353208..353726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_325"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_325"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17154"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ53"
FT                   /protein_id="BAG17154.1"
FT                   /translation="MPRTMSVADSIVIDASPAQVYEQLSDPTAMGRWSPENRGATVRGE
FT                   QRAAYVGMVFEGRNKRGAARWTTRCTVTAADPGERFAFRVHAIGLRRPLLPGPIATWDY
FT                   RFEAVDGATRVTETWTDDRRRWPDFLANAFDRVATGGKTFAQFQGGNIRTTLKRLKAAL
FT                   EADARGTGS"
     gtgccccgca ccatgtccgt agcggacagc atcgtcatcg acgccagccc ggcgcaggtc        60
     tatgaacagc tcagcgatcc cacggcgatg ggtcgttgga gcccggagaa ccgtggcgcg       120
     accgtccgcg gcgaacaacg tgctgcatac gtcggcatgg tcttcgaggg ccgcaacaag       180
     cgcggtgcgg cgcgctggac gacacggtgc acggtgacgg cggccgaccc cggcgagcgc       240
     ttcgcctttc gggtgcacgc gatcggcctg cggcgcccac tgctcccggg gcccatcgcc       300
     acgtgggact accgtttcga ggcagtggac ggggcgaccc gggtcaccga gacgtggacc       360
     gacgaccggc gtcgctggcc tgacttcctc gccaacgcgt tcgaccgcgt cgctacgggc       420
     gggaagacct tcgcgcagtt ccagggcggc aacatccgta cgacgctgaa gcgtctcaag       480
     gcagccctgg aggcggacgc ccgcggcacc ggaagctga                              519
//

If you have problems or comments...

PBIL Back to PBIL home page