(data stored in ACNUC7421 zone)

EMBL: AP009493.PE326

AP009493.PE326       Location/Qualifiers
FT   CDS_pept        complement(353767..354609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_326"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_326"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17155"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ54"
FT                   /protein_id="BAG17155.1"
FT                   /translation="MPDNEPRTMPDNGRGALRADCANCFALCCVALTLTASTDFAIDKD
FT                   AGRPCPNLRDDFRCGIHTRLRPKGFSGCTVYDCFGAGQQVSQVTYGGRDWRSSPDIAAQ
FT                   MFQVFPVMRQLHELLWYLTEALTLPDARPLHDEIRRALDETERHTGRPAVDFSDLDIAG
FT                   HRDRVAGLLLRTSERVRAAAPRRKRRNHRGADLIGARLRGADLRAADLRGAYLIAADLT
FT                   GADLRLADLIGADFRDADLSDADLTGSLFLTQAQLNAAKGNGKTALPASLSRPPHWAT"
     gtgcccgaca acgaaccgag gaccatgccc gacaacggac ggggggcgct gcgggcggac        60
     tgcgcgaact gtttcgccct gtgctgcgtc gccctcacgc tgacggcctc cacggacttt       120
     gccatcgaca aggacgccgg gcggccctgc cccaaccttc gggacgactt ccgttgtggc       180
     atccacaccc ggctgcgtcc gaagggcttc tccggctgca ccgtgtacga ctgcttcggc       240
     gccggtcaac aggtctccca ggtgacctac ggtggccggg actggcgttc gtctccggac       300
     atcgccgcgc agatgttcca ggtcttcccg gtcatgcgcc agctccacga actgctgtgg       360
     tatctcaccg aggccctcac cctgccggac gcccgtcccc tccacgacga gatccgccgg       420
     gcactcgacg agacggaacg acacaccggg cgcccggccg tcgacttctc ggacttggac       480
     atcgccggtc accgggaccg ggtcgccggg ctgctcctgc gcaccagcga acgcgtccgg       540
     gccgccgcgc cccgccgcaa gaggcgcaac caccgcggtg ccgacctcat cggggcccgt       600
     ctgcggggag ccgacctgcg tgcggcggac ctccgtgggg cctatctgat cgccgccgat       660
     ctcaccggcg ccgacctccg cctggccgac ctcatcggtg cggacttccg tgatgcagac       720
     ctctcggacg ccgacctcac gggaagcctg ttcctcaccc aggcgcaact caacgccgcc       780
     aagggcaacg ggaagacggc actgcccgcc tccctgagcc gccctccgca ctgggcaacc       840
     tga                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page