(data stored in ACNUC7421 zone)

EMBL: AP009493.PE334

AP009493.PE334       Location/Qualifiers
FT   CDS_pept        complement(361537..362667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_334"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_334"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17163"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ62"
FT                   /protein_id="BAG17163.1"
FT                   /translation="MTVKQALRAHTVAQDADTKVRAVRARTRGARVNGTSVRGDARTGD
FT                   VGTEPEGEGVRTASAAPAVTVAAGRAAQELGIRRAEFELAVHLGQIAVVGVPGGGRPRV
FT                   HEEEIARLREQPGFPDGLAERVRTVGTAEGAALLDIAPARFTRLARAGCVSPVTFYLNR
FT                   YRAVVWLYLADELAAFAAREPDLLAGRTPPGMRSTLESGADWRPRNWRSQRIDRLLNRT
FT                   RDPWVRAAVQASALDPVQLAEVVDDPYERAYLVRVRPEPVFGRPGSLAAREAMGQLMLA
FT                   DDPDEILWRRVNLTLELDGARADRPAPRPGEDGATRAATAVRSGADTRGGTGLVPFAAE
FT                   PAPPPADAGLSTSAAKAAPTGKGLLARLGRRGRGTG"
     atgacggtca agcaggcgct ccgtgcacac accgtggcac aggacgcgga caccaaggtc        60
     cgggcggttc gggccaggac ccggggcgcg cgtgtcaacg gcacgagcgt acggggcgac       120
     gcccgtaccg gggacgtcgg cacggagccg gagggcgagg gcgtgcgaac cgcgtccgcc       180
     gccccggcgg tgacggtcgc ggccgggcgg gcggcccagg agttgggcat ccggcgagct       240
     gagttcgagc tcgcggtgca cctggggcag atcgccgtcg tcggcgtacc gggcggtggg       300
     cggccacggg tgcacgagga ggagatcgcg cgcctgcggg agcagccggg cttccccgac       360
     ggtctggcgg agcgggtccg caccgtcggg acggcggaag gagcggccct gctggacatc       420
     gctccggcgc ggttcacccg gcttgcccgg gcgggctgcg tctcaccggt cacgttctat       480
     ctcaaccggt accgcgcggt ggtctggctc tacctcgcgg acgagcttgc cgccttcgcg       540
     gccagggaac cggacctgct ggccggacgg acaccgccgg ggatgcgctc gacgctggag       600
     tccggagccg actggcggcc gcgcaactgg cgctcacagc gcatcgaccg gctactgaac       660
     cgcacgaggg acccctgggt gcgagcggcg gtccaggcgt cggcactgga ccccgtgcaa       720
     ctggcggaag tggtggacga cccctacgaa cgcgcctatc tcgtgcgcgt ccggccggag       780
     ccggtcttcg gacgcccggg ctccctggcg gcgagggagg ccatggggca actgatgctg       840
     gccgatgacc ccgacgagat cctctggcgc cgggtcaacc tgacgctgga gcttgacggg       900
     gcccgcgcgg accggccggc cccgcgcccc ggggaggacg gggcgacccg agcggcgacc       960
     gccgtccgga gcggcgcgga cacccgtggc gggaccgggc tcgtgccctt tgccgccgag      1020
     ccggctccgc cacccgccga cgccgggttg tcgacctccg ccgcgaaggc tgcgccgacc      1080
     ggaaaggggc tgctcgcacg gctgggccgg cgcgggcgcg gcaccggata g               1131
//

If you have problems or comments...

PBIL Back to PBIL home page