(data stored in ACNUC7421 zone)

EMBL: AP009493.PE335

AP009493.PE335       Location/Qualifiers
FT   CDS_pept        complement(362777..363190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_335"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_335"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17164"
FT                   /db_xref="InterPro:IPR004942"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ63"
FT                   /protein_id="BAG17164.1"
FT                   /translation="MPLDRGLDWLLDDLTNRVQFIRHALVLSNDGLVTGASTGLAREDA
FT                   EHLAAVSSGLQSLARGSGRHFRAGRARQTMVEFDEALLFVTAAGDGSCLCVLTAAEADV
FT                   GQVAYEMTLLVNRVGEHLGVSVRQGGPDDTGPV"
     atgccgcttg accggggact tgactggctc cttgacgatc tcaccaacag ggtgcaattc        60
     atacggcacg ccttggtgct gtcgaacgac ggactggtca ccggggccag caccgggctg       120
     gcccgcgagg acgcggagca cctggcagcg gtctcctccg gcctgcagag cctggcgcgc       180
     ggctcggggc ggcacttccg ggcggggcgt gcccgccaga ccatggtcga gttcgacgag       240
     gcgctgctgt tcgtgacggc cgccggcgac ggcagctgtc tgtgcgtgct gacggcggcc       300
     gaagccgatg tcggccaagt cgcctacgag atgaccctgc tggtcaaccg ggtcggcgaa       360
     cacctcggag tctcggttcg ccagggcggt cccgacgaca ccgggcccgt gtga             414
//

If you have problems or comments...

PBIL Back to PBIL home page