(data stored in ACNUC7421 zone)

EMBL: AP009493.PE336

AP009493.PE336       Location/Qualifiers
FT   CDS_pept        363331..363759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_336"
FT                   /product="putative pyridoxamine 5'-phosphate
FT                   oxidase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_336"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17165"
FT                   /db_xref="GOA:B1VQ64"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019920"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ64"
FT                   /protein_id="BAG17165.1"
FT                   /translation="MAHHMTEEEWRAFLSQGTRTAKVSTVRADGSPHIAPVWFLLDGDS
FT                   VVFNTGAQSVKGRNLTRDGRVSLCVDDDRPPYAFVVVQGRAELSTDPGELLRWATLIAH
FT                   RYVDDEAFEEFGRRNGVPGELIVRVRIDKVVAMADMIG"
     atggcacacc acatgaccga agaagaatgg cgggccttcc tctcgcaggg cacgcgcacg        60
     gccaaggttt cgacggtgcg ggccgacggc agtccgcaca tcgcacccgt ctggttcctt       120
     ctggacggcg attcggtggt cttcaacacc ggtgcgcaga gtgtcaaggg gcgcaacctc       180
     acacgcgacg gacgggtctc cctctgcgtc gacgacgacc ggcccccgta cgcgttcgtg       240
     gtcgtgcagg ggcgcgccga actgagcacg gaccccgggg aactgctgcg gtgggcgacg       300
     ctgatcgccc accgttacgt ggacgacgag gccttcgagg agttcggcag gcgcaacggc       360
     gtgccgggcg aactgatcgt tcgggtgcgg atcgacaagg tggtcgcgat ggccgacatg       420
     atcggctga                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page