(data stored in ACNUC7421 zone)

EMBL: AP009493.PE337

AP009493.PE337       Location/Qualifiers
FT   CDS_pept        complement(363787..364086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_337"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_337"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17166"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ65"
FT                   /protein_id="BAG17166.1"
FT                   /translation="MPGRALAAILPADTRRLGDCFTAVDHVERERIPYTAAVNRFPDAP
FT                   EHTPCDIARALDLNRSTPVLLCDPRAPASGKEVLIRTVEYAGRVHTAPLLASVG"
     gtgccagggc gcgccctcgc ggcgatcctg ccggcggaca cccggcgtct cggtgactgc        60
     ttcaccgccg tcgaccacgt cgagcgcgag cggattccgt acaccgccgc cgtcaaccgg       120
     ttccccgacg cccctgagca cactccgtgc gacatcgcgc gggcgctcga cctcaaccgg       180
     agcacaccgg tcctgctgtg cgacccccgt gccccggcat ccggaaagga agtcctgatc       240
     cgtacggtcg agtacgccgg gcgcgtgcac accgccccac tcctcgcgtc cgtcgggtga       300
//

If you have problems or comments...

PBIL Back to PBIL home page