(data stored in ACNUC7421 zone)

EMBL: AP009493.PE341

AP009493.PE341       Location/Qualifiers
FT   CDS_pept        368237..368812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_341"
FT                   /product="putative TerD-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_341"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17170"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ69"
FT                   /protein_id="BAG17170.1"
FT                   /translation="MGVTLAKGGNVSLSKEAPGLTAVTVGLGWDVRTTTGADHDLDASA
FT                   LLCSEAGKVLSDAHFVFYNNLNSPDGSVRHTGDNLTGEGEGDDESVEVDLASVPAEIAK
FT                   IVFPVSIHDAQSRGQSFGQVRNAFIRVVNRANGVELARYDLSEDASTETAMVFGELYRH
FT                   GAEWKFRAVGQGYASGLAGIASDYGVNV"
     atgggtgtga ccctggccaa gggcggcaac gtctccctgt cgaaggaggc ccccggcctg        60
     accgccgtga cggtcgggct cggctgggac gtacggacca cgaccggagc cgatcacgac       120
     ctggacgcca gcgcgctgct gtgctccgag gcgggcaagg tcctctccga cgcccacttc       180
     gtcttctaca acaacctcaa cagccccgac ggttccgtcc gccacaccgg tgacaacctg       240
     acgggtgagg gcgagggaga cgacgagtcg gtcgaggtcg acctggcgtc ggtccccgcc       300
     gagatcgcga agatcgtgtt ccccgtgtcc atccacgacg cccagagccg gggccagagc       360
     ttcggtcagg tgcgcaacgc gttcatccgc gtggtgaacc gggccaacgg cgtcgagctc       420
     gcccggtacg acctgagcga ggacgcctcc accgagaccg cgatggtctt cggcgagctg       480
     taccggcacg gcgccgagtg gaagttccgg gccgtcggcc agggttacgc ctccgggctg       540
     gcgggcatcg cctcggacta cggcgtcaac gtctga                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page