(data stored in ACNUC7421 zone)

EMBL: AP009493.PE343

AP009493.PE343       Location/Qualifiers
FT   CDS_pept        complement(369588..370478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_343"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_343"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17172"
FT                   /db_xref="InterPro:IPR018713"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ71"
FT                   /protein_id="BAG17172.1"
FT                   /translation="MVKRYDRLKEIQRLDPERDFLEIYRLTVTHEFPWDVTRALELALY
FT                   RTYAVPSIGRLLDETAELTERSQKRYDDTALLLDTVVEHGFDTDDGRTAVRRINRMHRS
FT                   YDISNDDMRYVLCTFVVTPKRWLDRFGWRRLCCHERAAFAAYYRTLGAHMGIREVPETY
FT                   EDFERALDAYEHEHFGWDEGARRVADATLALMASWYPAPLAPLVRGASLALLDDSLLGA
FT                   FRYPRPGPVARGVTRGALRLRARAVRLLPPRRTPHYARQNPEIKGYPNGYEIAELGTFP
FT                   TPGVRGCPVPGHRRP"
     gtggtgaagc ggtacgaccg gctgaaggag attcagcgac tcgaccccga gcgggacttc        60
     ctggagatct accgcctcac cgtcacccac gaattcccct gggacgtcac ccgcgccctc       120
     gaactggccc tctaccgcac ctatgccgtg cccagcatcg gccgactcct cgacgagaca       180
     gcggagttga cggagcgctc ccagaagcgc tacgacgaca ccgctctgct gctcgacacc       240
     gtcgtggagc acggtttcga caccgacgac ggccgcaccg ccgtccgccg catcaaccgg       300
     atgcaccgca gctacgacat cagcaacgac gacatgcgct atgtcctgtg cacgttcgtc       360
     gtcaccccga agcgctggct ggaccgcttc ggctggcggc ggctgtgctg ccacgagagg       420
     gccgccttcg ccgcctacta ccgcacgctc ggcgcgcata tggggatcag ggaggttccg       480
     gagacctacg aggacttcga gcgcgccctc gacgcctacg agcacgagca tttcgggtgg       540
     gacgaaggag cccgccgggt ggccgacgcg accctggccc tgatggcgtc ctggtatccg       600
     gcgcccctcg ccccgctggt gcggggggcc agcctcgcgc tcctggacga ctcgttgctc       660
     ggggcgttcc gctacccccg cccgggtccg gtggcccgcg gggtgaccag gggcgcgctc       720
     cggctccggg cccgagccgt ccggctcctg ccgccccgga ggacccccca ctacgcgcgc       780
     cagaaccccg agatcaaggg ctatccgaac gggtacgaga tcgccgagct cggtacgttc       840
     cccacgccgg gcgtccgtgg ctgcccggtt cccggccacc gtcggccgta g                891
//

If you have problems or comments...

PBIL Back to PBIL home page