(data stored in ACNUC7421 zone)

EMBL: AP009493.PE344

AP009493.PE344       Location/Qualifiers
FT   CDS_pept        370666..371565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_344"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_344"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17173"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ72"
FT                   /protein_id="BAG17173.1"
FT                   /translation="MRRRAMSDEENTVAGVDSDVADDALLVLTAMMLTPARFPSVLGDD
FT                   YVAACGALALEPYEEGYGLVLGQDGDGARWTVVVEDASQVAVAIAAWDCGMEHDLSPDE
FT                   RSMVCALPGWPMDLAVSAPGVPDPHDPAVDGDGPAPLAPPDAEAWGPAQRRLGADEIAA
FT                   QWSMWREQLDGVEGSRPGAEGEPGSGAGGEQSGDAGSERDGEPFSAPRHPGVRRALSEA
FT                   TAYTKEPPPAGRIRSSYASADARTLRVDGPGWSMVARTDDIALFLLDEEPGTVIPVRRG
FT                   AALPGLLAALDGLAARPA"
     atgaggaggc gggcgatgag cgacgaggag aacaccgtgg caggcgtgga cagtgatgtc        60
     gccgacgacg cgctgctggt gctgaccgcg atgatgctga ccccggcgcg gttccccagc       120
     gtgctggggg acgactacgt ggcggcgtgc ggcgcgctcg cgctcgaacc gtacgaggag       180
     ggttacgggc tcgtcctcgg gcaggacggc gacggagccc ggtggaccgt ggtcgtcgag       240
     gacgcctccc aggtggccgt cgccatcgcc gcctgggact gcggcatgga gcacgacctc       300
     tcccccgacg aacgctccat ggtgtgcgcg ctgccgggct ggccgatgga cctcgccgtc       360
     tccgcgcccg gtgtgccgga tccgcacgat ccggctgtgg acggggacgg cccggcaccc       420
     ctggccccgc ccgacgcgga ggcctggggc ccggcgcagc gaaggctcgg ggcggacgag       480
     atcgcagcgc agtggtcgat gtggcgcgag cagctcgacg gggtggaggg ctcacggccg       540
     ggcgccgagg gagagccggg gagcggagcc gggggcgagc agtcgggcga tgccggaagc       600
     gagcgggacg gcgagccctt ctcagctccc cggcaccccg gtgtccgcag ggccctgtcg       660
     gaggcgaccg cctataccaa ggagccgccg ccggccgggc ggatccgttc ctcgtacgcc       720
     tcggccgacg cacggacgct gcgcgtcgac ggcccggggt ggtcgatggt ggcccggacc       780
     gacgacatcg ccctcttcct gctggacgag gagccgggca cggtcattcc cgtcaggcgc       840
     ggcgccgcgc tgcccgggct gctcgcggcc ctcgacggct tggccgcccg ccccgcgtga       900
//

If you have problems or comments...

PBIL Back to PBIL home page