(data stored in ACNUC7421 zone)

EMBL: AP009493.PE348

AP009493.PE348       Location/Qualifiers
FT   CDS_pept        376204..377610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_348"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_348"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17177"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ76"
FT                   /protein_id="BAG17177.1"
FT                   /translation="MSDGYEDDDHAYGTGYGADGPDSFDGGDDEASRGGGRGTERVFAA
FT                   FPPAQGRGFATSWWGRAWLKALEDTALDGQQLKQGRRLAREGRVGAVSVRPGRITAVVR
FT                   DRDGSAYRSDVLLQQLGTGAWDRFLDMAVDRAGHIAALLDREMPPHLVEDAAGAGVELL
FT                   PGIGDLEPECTCGAWDHCPHSGALCYQVARLLDEDPFVLLLMRGREERRLLDELQVRSA
FT                   ARAVRAGGDGAREAADDAERNVHGVPAAEAFAAAGILPPLPAPPPVPVEPGLGPALDTE
FT                   TAPAPGVDPAALEVLAADSAVRAHRMLLDALAPGHEGQPVPVELTPRQDAVRLAADTRP
FT                   EPRIGARLAARSGRPAADLDAAVRAWRYGGVAALAVLDEEWTPDPEDLARGRARLGEAW
FT                   EAGERPALRANGRARWTVAGADLQLRLDRNGRWWPYRKERGRWVPAGPADDDPAGALAG
FT                   ADGAAADAAV"
     atgagcgatg gctacgagga cgacgaccac gcgtacggga cggggtacgg ggcggacggc        60
     ccggactcct tcgacggggg cgacgacgag gcgtcgcggg gcggcgggcg cgggacggag       120
     cgcgtgttcg cggcgttccc gcccgcgcag ggccggggtt tcgcgacctc ctggtggggg       180
     cgggcgtggc tcaaggccct ggaggacacg gcgttggacg gccaacagct caagcagggc       240
     cggcggctgg cccgggaggg cagggtcggg gcggtctccg tgcggccggg acggatcaca       300
     gcagtcgtcc gggaccggga cggctcggcg taccgcagcg atgtcctgct gcaacagctc       360
     ggcacgggcg cctgggaccg gttcctggac atggccgtgg accgggccgg gcacatcgcc       420
     gcgttgctgg accgggagat gccgccgcac ctcgtggagg acgcggcggg cgccggtgtc       480
     gaactgctgc ccggtatcgg agacctggag ccggagtgca cctgtggggc ctgggaccac       540
     tgcccgcact cgggcgccct ctgctaccag gtggcgcggc tgctggacga ggacccgttc       600
     gtcctgctgc tgatgcgggg gcgcgaggag cggcggctgc tggacgagct ccaggtgcgc       660
     agcgccgccc gtgcggtcag ggcgggcggc gacggggcgc gggaggcggc cgacgacgcg       720
     gaacgaaacg ttcacggagt cccggccgcc gaagcgttcg cggcggccgg gatcctgccg       780
     ccgctccccg ctcccccgcc ggtccccgtc gaaccgggac tcgggcccgc gctggacacg       840
     gagaccgccc ccgcgcccgg ggtcgacccg gcggcgctgg aggtgctggc ggcggacagc       900
     gcggtgcggg cgcaccggat gctgctggac gcactggccc cggggcacga aggacagccg       960
     gtcccggtcg agctgactcc gcggcaggac gcggtacggc tggccgcgga cacccggccc      1020
     gagccgcgta tcggggcccg gctggccgcg aggtcgggcc ggccggccgc ggacctggac      1080
     gccgccgtcc gcgcctggcg gtacggcggg gtcgcggcac tcgccgtgct ggatgaggag      1140
     tggacgccgg acccggagga cctggctcgg ggccgcgccc ggctcggcga ggcgtgggag      1200
     gcgggcgagc gaccggccct gcgggcgaac ggccgggccc gctggaccgt cgcgggcgcc      1260
     gacctccagc tccggttgga ccggaacggg cggtggtggc cctaccgcaa ggagcgcggt      1320
     cgatgggtcc ctgccggacc ggcggacgac gacccggcgg gcgcgctggc gggggccgac      1380
     ggcgcagcgg cggacgcggc agtctga                                          1407
//

If you have problems or comments...

PBIL Back to PBIL home page