(data stored in ACNUC7421 zone)

EMBL: AP009493.PE352

AP009493.PE352       Location/Qualifiers
FT   CDS_pept        complement(381837..382496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_352"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_352"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17181"
FT                   /db_xref="InterPro:IPR025326"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ80"
FT                   /protein_id="BAG17181.1"
FT                   /translation="MRMNRLAVTAVAVVAGLSLSACGGDDDATDTAAPSSPSATSAGTP
FT                   TQSSSPEEGDSAGTAPEEGAADQGSTGQESGGTGKIERCHTDDLTIKASDATIGDDPTK
FT                   AVAVELRNTSNRSCSIKGFAGVNLLSSEGAIPATRRDQKDDGTTLKAGEPTFFGIFYKG
FT                   NDSGGSGVKIKGLVVTPPDERKSVTLKWPGEPSLPITDSPETTVEIGPMGSIGQGG"
     atgcgcatga acaggcttgc cgtcaccgcc gtcgctgttg tggcgggact gtccctttcg        60
     gcgtgcgggg gtgacgacga cgcgacggac accgccgccc cgtcctcgcc gagcgccacc       120
     tccgccggga cgccgaccca gtcgtcctcg ccggaggagg gcgactccgc cggcaccgcc       180
     cctgaagagg gggcggcgga tcagggctcg acgggccagg agtccggcgg caccgggaag       240
     atcgagaggt gccacacgga cgacctgacg atcaaggcga gtgatgccac catcggcgac       300
     gacccgacca aggccgtagc cgtggaactg cgcaacacat ccaatcggag ttgttccatc       360
     aaggggttcg ccggtgtgaa cctgttgtcg agtgagggcg cgatccccgc gacgcgccgg       420
     gaccagaagg acgacgggac gaccctgaag gccggtgagc ccaccttctt cggcatcttc       480
     tacaagggga acgactccgg cggttccggc gtgaaaatca agggactcgt cgtcacgccg       540
     ccggacgaga ggaagtccgt caccctgaag tggcccggcg agccctcgct ccccatcacc       600
     gacagccccg agaccacggt ggagatcgga ccgatgggca gcatcggcca gggtggctga       660
//

If you have problems or comments...

PBIL Back to PBIL home page