(data stored in ACNUC7421 zone)

EMBL: AP009493.PE356

AP009493.PE356       Location/Qualifiers
FT   CDS_pept        386408..388015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_356"
FT                   /product="putative phytoene dehydrogenase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_356"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17185"
FT                   /db_xref="GOA:B1VQ84"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ84"
FT                   /protein_id="BAG17185.1"
FT                   /translation="MNRFDVVVVGGGHNGLVTAAYLGRAGLRVAVIESRQRLGGPCGGY
FT                   AFLPGRSLAFTNSPGSLNPAVVHELRLADHGLRFVRADPTVVQQFDGRCFLGWRDPARV
FT                   DRQLDAFAPGEADRYRELISALERLGASLRVSLDEPPPGLAELRERLTDPEEHKLFSAV
FT                   FEGSLTGLLETRLVSDQAKALLALLALNAQLVPPSTPGSAVGLMMRPFALAAAGAPRSG
FT                   DAAERVALRGSTGLPVGSMSAIVDALEDCCRTHDVTLRTGSPVVRILHGPAGVRGVVTA
FT                   TGEEFTADRVVSAVNPVHLFRDLLDDAAMGPGIRAEVAGTAMRGSAFKVVLEVDSLPAY
FT                   AGLPADADPERVRACQFRVGSSLGGIEESISRALLGHASDQPLMWGLIPTLTSPGLTPG
FT                   KTHLISVNAWHAPYRPHDGPWDAERTDRFGRRCVEELSRLMPGLADRVVDHRFMNPVEI
FT                   ESELGLMESNITHGDMLPGNLFGARPHPEVAGYRTPLPGFYVSGAGTWPGGYVTGTPGR
FT                   NTAKAVLQDLHHEQRRQA"
     atgaaccggt ttgacgtggt ggttgtcggg ggcggtcaca acgggctggt caccgcggcc        60
     tatctgggcc gggcgggact gcgcgtcgcc gtgatcgaat cccggcagcg cctcggcggg       120
     ccctgcggag gatacgcatt cctgcccggc cgcagtctgg ccttcaccaa ctcgcccggg       180
     tcactgaacc cggcggtcgt ccacgaactc cggctcgccg accacggcct ccggttcgta       240
     cgggccgacc cgaccgtggt ccagcagttc gacggccggt gcttcctcgg ctggcgcgac       300
     cccgcccgcg tcgaccggca gctcgacgcc ttcgcacccg gcgaggccga ccgctaccga       360
     gagctgatca gcgccctcga acggctcggc gcgagcctgc gggtctccct ggacgagccc       420
     ccgcccggcc tcgccgaact gcgggagcgg ctgaccgacc cggaggagca caagctcttt       480
     tccgccgtct tcgagggcag cctcaccggg ctgctcgaga cgcgtctcgt gtcggaccag       540
     gccaaggcgc tgctcgcact gctggcgctg aacgcccaac tcgtaccgcc gtcgacgccc       600
     ggcagcgccg tcggactgat gatgcgcccg ttcgccctgg ccgcggcggg cgcaccccgc       660
     tcgggcgacg cggccgagcg ggtcgcgctc cgcggttcca ccggcctccc ggtcgggtcg       720
     atgagcgcga tcgtggacgc gctggaggac tgctgccgca cccacgacgt caccctgcgc       780
     accgggtccc cggtggtacg tatcctgcac ggtcccgccg gggtccgggg cgtggtcacc       840
     gcgaccggcg aggagttcac cgccgaccgg gtggtgtcgg cggtcaaccc cgtccacctc       900
     ttccgcgatc tgctggacga cgcggcgatg ggtcccggga tccgggccga ggtcgccggc       960
     acggcgatgc gcggatcggc tttcaaggtc gtcctggagg tggactcgct gcccgcctac      1020
     gcggggctcc ccgcggacgc ggatcccgag cgggtccggg cctgccagtt ccgggtcggc      1080
     tcctcgctcg gcgggatcga ggagtcgatc tcccgggccc tgctgggcca cgccagcgat      1140
     cagcccctga tgtgggggtt gataccgacc ctcacctcac cgggcctcac cccggggaag      1200
     actcatctca tcagtgtcaa cgcctggcac gccccctacc gcccgcacga cggcccctgg      1260
     gacgccgagc gcacggaccg cttcggccgc cgctgcgtcg aggaactctc ccgactgatg      1320
     ccgggactcg ccgaccgcgt cgtcgaccac cggttcatga acccggtgga gatcgagagc      1380
     gagctgggcc tgatggaaag caacatcacc cacggggaca tgctgcccgg gaatctcttc      1440
     ggagcccgcc cgcaccccga ggtcgccggc taccgcaccc cgctcccggg cttctacgtc      1500
     agtggcgcgg ggacctggcc cggcggctac gtcaccggaa cacccggcag gaacacggcc      1560
     aaagcggtgc tccaggacct tcaccacgag cagaggcgac aagcatga                   1608
//

If you have problems or comments...

PBIL Back to PBIL home page