(data stored in ACNUC7421 zone)

EMBL: AP009493.PE359

AP009493.PE359       Location/Qualifiers
FT   CDS_pept        390630..391577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_359"
FT                   /product="putative peptide ABC transporter permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_359"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17188"
FT                   /db_xref="GOA:B1VQ87"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ87"
FT                   /protein_id="BAG17188.1"
FT                   /translation="MLTFTLRRALHMLPVILGVTIATFGLGQIIPGDQASALLGPTASE
FT                   ADRQALREDLGLDEPAVSRYFTYLGSLFDGDLGRSLSFGRPVSEVLSDRLLNTLLLSGT
FT                   AIVLAAVVGVAIGTWAAQKPGSHRDRSLTVGVLFFNSVPSFWFGLVLIIVFSLQLRMLP
FT                   ATGMTSIGGGGALDVAAHMVLPVITLAAWSLAVIARMTRSSVLEVIGNDYVRTARSRGV
FT                   GEFRVIVRHVLPNAMPSVITVIGLQAGFLLSGAVLTETVFSWPGIGLALHQAISARDIP
FT                   LVQGGILVIAIAFVLINFLVDVLQAYFNPKIKLA"
     atgctgacct tcacgctgcg ccgcgcgctg cacatgctcc cggtcatcct cggggtgacc        60
     atcgccacct tcggcctcgg ccagatcatc cccggcgacc aggcgagcgc cctgctcggc       120
     cccaccgcgt ccgaggccga ccgccaggcg ctccgcgagg atctcggcct ggacgaaccg       180
     gccgtctccc gctacttcac ctacctcggc agcctcttcg acggcgacct gggccgttcg       240
     ctctccttcg gccggccggt ctccgaagtc ctctccgacc ggctgctcaa caccctgctg       300
     ctgtcgggca ccgcgatcgt gctcgcggcg gtcgtgggcg tcgccatcgg cacctgggcc       360
     gcccagaagc ccggttcgca ccgggaccgg agcctcaccg tcggcgtgct gttcttcaac       420
     tccgtaccgt cgttctggtt cgggctggtg ctcatcatcg tcttctcgct gcagctgagg       480
     atgcttcccg ccaccgggat gacctccatc ggcggcggcg gagccctcga cgtggcggcc       540
     cacatggtgc tgccggtgat caccctcgcc gcgtggtcgc tggcggtcat cgcccggatg       600
     actcgctcct cggtgctcga ggtcatcggc aacgactacg tccgcaccgc ccgctcacgc       660
     ggtgtcggcg agttccgggt gatcgtgcgc catgtgctcc ccaacgccat gccgtccgtg       720
     atcacggtga tcggcctgca ggcgggcttc ctgctcagcg gcgcggtgct caccgagacg       780
     gtgttctcct ggccgggcat cggcctcgcc ctccaccagg cgatctccgc ccgggacatc       840
     cccctcgtcc agggcgggat cctcgtgatc gccatcgcgt tcgtactgat caacttcctg       900
     gtcgacgtgc tccaggcgta cttcaacccg aagatcaagc tggcttag                    948
//

If you have problems or comments...

PBIL Back to PBIL home page