(data stored in ACNUC7421 zone)

EMBL: AP009493.PE36

AP009493.PE36        Location/Qualifiers
FT   CDS_pept        40151..40579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_36t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_36t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16865"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:B1VKM0"
FT                   /protein_id="BAG16865.1"
FT                   /translation="MSMRSSARFRSTITGAAVCSALALGSVLAGPGTAVASAETGQNST
FT                   SVSAASCNVIYRVSTNYKGWTANYSWAWNINVAQGDTGDRVREIQCLLIFKGFGVGAVD
FT                   GDFGPATRTAVVAFQKNRGLDYDGIVGANTWRKLRVRD"
     atgagcatgc ggtcatcggc gcgtttccgc agcacgatca ccggagcggc tgtctgctcc        60
     gccctcgcac tgggaagcgt gctggcggga cccggcacgg cagtcgcctc ggcggagacg       120
     gggcagaact cgacgtccgt ctccgcggct tcgtgcaacg tcatctatcg ggtatcgacg       180
     aactacaagg gatggaccgc gaattacagc tgggcgtgga acatcaacgt cgctcaggga       240
     gacaccggag accgggtcag ggagatccag tgcctcctca tattcaaggg cttcggcgtg       300
     ggggcggtcg acggcgactt cggccccgca acccgtaccg cagtcgtggc gttccagaaa       360
     aacaggggcc tcgactatga cggcatcgtc ggggcgaaca cctggcgcaa gctgcgcgtg       420
     cgcgattaa                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page